KEGG   Raoultella planticola: B1209_00480Help
Entry
B1209_00480       CDS       T05298                                 

Definition
(GenBank) aquaporin
  KO
K02440  glycerol uptake facilitator protein
Organism
rpln  Raoultella planticola
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpln02000]
    B1209_00480
Transporters [BR:rpln02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    B1209_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AUV51535
UniProt: A0A2X2EY02
LinkDB All DBs
Position
complement(103316..104161)
Genome map
AA seq 281 aa AA seqDB search
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISIIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDGRKVVPFIISQFAGAFCAAALVYGLYYNLFFDFEHSHN
MVRGSVESLELAGIFSTYPNPHINFVQAFAVEMVITAILMGVILALTDDGNGIPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDLGPKTFAWLAGWGDVAFTGGKDIPYFLVPLCAP
VVGAALGAFSYRKLIGRHLPCDTCVEEEKESTSTTQHNASL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacatcaacattaaaaggccagtgcatcgcagagttcctcggtaccgggttg
ttgatctttttcggcgttgggtgcgtcgcggcgctcaaagttgcgggagccagcttcggt
cagtgggaaatcagcatcatctggggtctgggggtggccatggctatctacctgaccgcg
ggcgtatccggtgcgcaccttaacccggcggtcactatcgcattgtggctgtttgcctgc
ttcgacgggcgtaaagttgttccttttatcatttctcaattcgcaggcgccttttgcgcc
gcggcgttagtttacgggctttactacaatcttttcttcgatttcgaacacagccacaat
atggtgcgcggtagcgtcgaaagtcttgagctggccggtattttctccacttacccgaac
ccacacatcaattttgtgcaggctttcgcggtagaaatggtgattaccgctatcctgatg
ggcgttatcctggcactgactgatgacggcaatgggattccgcgtggtccgctggcgccg
ctactaatcggcctgttgattgcggttatcggcgcatccatgggaccgctgaccggattt
gccatgaacccggcccgcgacctcggaccaaaaacgtttgcctggcttgccggctggggc
gacgtcgccttcaccggcggtaaagatattccttatttcctggtgccgctgtgcgcaccg
gtggtgggcgccgcgctgggcgcgttcagctatcgtaagttgatcggccgccacctgcct
tgcgacacctgcgtcgaggaagagaaagagagcacctcgactacgcaacacaacgcttcg
ctgtaa

DBGET integrated database retrieval system