KEGG   Raoultella planticola: B1209_01695Help
Entry
B1209_01695       CDS       T05298                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpln  Raoultella planticola
Pathway
rpln00564  Glycerophospholipid metabolism
rpln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B1209_01695
Enzymes [BR:rpln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B1209_01695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AUV51738
UniProt: A0A2X2ED29
LinkDB All DBs
Position
complement(372104..373612)
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHLAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVRTRTRAISAKRENG
LWIVEAEDIDTGEKFTWQARGLVNATGPWVKHFFDEGMHLRSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYNGDPQKVAIDDNEINYLLNAYNAHF
KKTLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDEQGQAPLLSVFGGKLTTYRK
LAEHALEKLTPYYKGIGPAWTKTAVLPGGDIDGDRDDYAAKLRRRFSFISESMARHYART
YGSNSELILAEAASIADLGEDFGHEFYEAELKYLVEHEWVRTLEDAIWRRTKQGMWLNDQ
QQARIGEWLAQHAGKSELSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagatctgattgtgatagggggaggcatcaacggtgccggtatcgcggca
gacgccgccgggcgtggtttatccgtactgatgctggaagcacgcgatctcgcctgcgcc
acttccagcgccagttcgaagctgattcacggcgggctgcgctacctcgaacactacgaa
ttccgcctcgtcagcgaagcgctggccgaacgtgaagtgctgttaaaaatggcgccgcat
ctcgcctttccgatgcgctttcgtctgccgcatcgcccgcacctgcgtccggcatggatg
atccgtattggtctgtttatgtacgatcacctggggaaacgtaccagcttacccggctca
accggcttgcgatttggcgcagaatcggtattaaaacctgaaatcgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcgcgtctggtactggctaacgcgcagatggtggta
cgcaaaggtggcgaggtccggacccgtacccgggcaatttcggcgaaacgtgaaaacggc
ctgtggattgtcgaggcggaggatatcgataccggcgagaaattcacctggcaggcccgt
ggcctggtcaatgcgaccggcccgtgggtcaaacacttctttgacgaagggatgcacctg
cgctcaccgtacggcattcgcttgattaagggcagccatattgtggtgccgcgcgtgcac
acccagaagcaggcctacattctgcaaaacgaagacaaacgcattgtgttcgtgatccca
tggatggatgagttctcgataatcggtaccaccgacgttgagtacaacggcgatccgcag
aaagtggcgatcgatgacaacgagatcaactatctgctgaacgcctataacgcacacttc
aaaaagacgctgtcccgtgacgatatcgtctggacctactccggcgtccgtccgctgtgc
gacgatgaatcggattcgccgcaggcgattacccgcgattacaccctggatatccatgac
gaacagggccaggcgccgctgctgtcggtatttggcggcaagctgacgacctatcgcaag
ctggccgagcacgcgctggaaaaactgacgccctactacaaaggcatcggtccggcctgg
accaaaaccgcggtgctgcccggcggggatatcgacggtgaccgcgacgattacgcggcc
aaactgcgccgccggttctcatttatcagcgaatcgatggcgcgtcactatgcccgcacc
tacggcagcaacagcgagctgatcctcgcagaggcggcatcgatagcggatttgggtgaa
gattttggccatgagttctatgaagccgagctgaaatacctggtggagcatgagtgggta
cgcactcttgaggatgccatctggcgccggacgaaacagggcatgtggctgaatgaccag
cagcaggcgcggatcggcgaatggctggcgcagcacgcgggaaagtctgagctttcgctg
gcgtcgtaa

DBGET integrated database retrieval system