KEGG   Raoultella planticola: B1209_17820Help
Entry
B1209_17820       CDS       T05298                                 

Definition
(GenBank) beta-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
rpln  Raoultella planticola
Pathway
rpln00061  Fatty acid biosynthesis
rpln01100  Metabolic pathways
rpln01212  Fatty acid metabolism
Module
rpln_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1209_17820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpln01004]
    B1209_17820
Enzymes [BR:rpln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     B1209_17820
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     B1209_17820
Lipid biosynthesis proteins [BR:rpln01004]
 Fatty acid synthase
  Component type
   B1209_17820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AUV54340
UniProt: A0A377T9D9
LinkDB All DBs
Position
3675133..3675651
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVIKMTETGGNYDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRVVNRRLIMGLADGEVLVDDRLIYTANDLKVGLFQDTSAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacgaaagaagaccttcttgcctctggccgtggtgaa
ctgtttggcgcaaaaggcccacagttacccgcgccgaatatgctgatgatggaccgcgtc
atcaaaatgactgagacgggtggtaactacgataaaggttatgttgaagcagaactcgat
attaacccggacctgtggttcttcggttgccactttatcggcgatccggttatgcctggc
tgtctggggctggatgccatgtggcagctggtaggcttctatctgggctggctcggtggc
gaaggcaaaggccgcgcgctgggagttggcgaggtgaaattcaccggccaggtactgccg
acggcaaagaaagtcacttaccgtattcacttcaaacgcgttgttaaccgtcgtctgatt
atgggcctggcggatggtgaagtgctggttgacgatcgtctgatctacaccgcaaacgat
ctgaaagtgggtctgttccaggatacgtccgcattctga

DBGET integrated database retrieval system