KEGG   Pararhodospirillum photometricum: RSPPHO_00026Help
Entry
RSPPHO_00026      CDS       T01851                                 

Gene name
bchL
Definition
(GenBank) Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00860  Porphyrin and chlorophyll metabolism
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSPPHO_00026 (bchL)
Enzymes [BR:rpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RSPPHO_00026 (bchL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_26 MeaB MipZ AAA_24 SRP54 AAA_25 CBP_BcsQ AAA_16
Motif
Other DBs
NCBI-ProteinID: CCG06652
UniProt: H6SIM4
LinkDB All DBs
Position
93572..94705
Genome map
AA seq 377 aa AA seqDB search
MMKRCASVLPPSTPRPRPGSRTAFWRLTSGSTGNLTKPRWKPCGAPARNWRTTWKTFRKE
WRHEQGPRERGNGQGKTPVGVMSVLESFESPPDGEGSVQVQMDPALSIGSAKVFAVYGKG
GIGKSTTSSNLAVAFSKLGKRVIQIGCDPKHDSTFTLTKCLIPTVIDALETVNYHTEELR
PEDFVFEGYNGVLCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLDDTDVVVFDVLGDVVC
GGFATPLHHAERALVVAANDFDSIFAMNRIIAAIRAKSKNYEVRLGGVICNRSDQTDQID
KFNDASGMRTLGRIPALDVIRRSRLKKATLFELEPTPEVEAVQREYLRIAQALWDGVEPL
DAHALKDRDIFDLLGYD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaagagatgcgcaagcgtcttgccgccctcaaccccacggcctcggcccgggtcg
cgaaccgccttctggaggctcacgagcggaagtactgggaacctgacgaagccacgctgg
aagccttgcggcgcgccggcgaggaactggaggacaacctggaaaacgtttcggaaggag
tggcggcatgaacaggggccgcgtgagcgggggaacgggcagggcaagaccccggtggga
gtcatgagcgtgcttgagtcctttgagtccccgcccgatggcgagggcagcgtgcaggtc
cagatggatccggcgctttcgatcgggtccgccaaggtctttgccgtgtatggcaagggc
ggcatcggcaagagcaccacgtcgtccaacctggcggtggccttctccaagctgggcaag
cgggtcattcagatcggctgtgatcccaagcacgactccaccttcaccttgaccaagtgc
ttgatccccacggtgatcgatgccttggaaacggtgaattatcacacggaagagttgcgg
cccgaagacttcgtgttcgagggctacaacggggtgctctgtgtcgaggccggcggtccc
cccgccggcaccggctgtggtggctatgtggtcggccagaccgtcaagctgctgaaggaa
catcatctgctcgacgacaccgacgtcgtggtcttcgacgtgctgggcgacgtggtgtgc
gggggctttgccacccccttgcaccacgccgaacgcgcgctggtggtcgcggcgaacgac
ttcgattccatcttcgccatgaaccgcattatcgcggccatccgggcgaagtcgaagaac
tacgaggtgcgcctcggcggcgtgatctgcaaccgctccgaccagaccgaccagatcgac
aagttcaatgatgcctcggggatgcgcaccctgggacggatccccgcgctcgacgtcatc
cggcgcagccgtctcaagaaagccaccctgttcgagctggaacccaccccggaagtggaa
gcggtgcagcgggaatacctgcgcatcgcccaggcgctctgggatggggtggagccgctg
gatgcccacgcgctgaaggacagggatatctttgatcttctggggtacgactga

DBGET integrated database retrieval system