KEGG   Pararhodospirillum photometricum: RSPPHO_01747Help
Entry
RSPPHO_01747      CDS       T01851                                 

Definition
(GenBank) Putative uncharacterized protein
  KO
K07090  uncharacterized protein
Organism
rpm  Pararhodospirillum photometricum
Brite
KEGG Orthology (KO) [BR:rpm00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RSPPHO_01747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: CCG08373
UniProt: H6SK58
LinkDB All DBs
Position
2105500..2106264
Genome map
AA seq 254 aa AA seqDB search
MDILLVSLAAMIASSVSLVSGFGLGTVLLPAFALMMPLPTAIAAAALVHLLQSGFKLLAT
GRAAQWGIVVRFGLPAVAGSLAGASALVVLGTGPELAVPWGADVLMTVKPLNVAVGLILI
AFALGDRPIARTGQSLPVAVGGLFSGFLGGVSGIQGALRSAVLSRVGLDKTAFIATGAVT
AALVDTSRVLVYGLSAADALAGAPPALLASAIIAAALGVAVGTRVVGKMTDQAVHTVTRG
LLVVFGGLLCVGVL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggacattcttctggttagcctcgcggccatgatcgcctctagcgtgtctttggtgtca
ggctttggcctgggaaccgttctcctgcccgcctttgccttgatgatgccgctgcccacg
gcgatcgcggcggcggcgctggttcatttgcttcagagcggctttaagcttctggccacg
ggtcgcgcggcgcagtgggggatcgtggtgcgctttggcctgccggcggtggcgggatcc
ctggctggagcctcggcgttggtggttttgggaaccggccccgagcttgccgtgccctgg
ggagccgacgtcttgatgaccgtcaagcccctcaacgtcgcagtgggcctgatcctcatt
gcgtttgctctgggcgatcggcccatcgcccgtactggtcaaagcctgcccgtggcggtg
ggggggctgttctctggtttcctcgggggggtgtcgggcattcaaggggcgctgcgttcg
gcggttttatcgcgcgttgggctcgacaaaaccgctttcatcgctaccggcgccgtcacc
gccgccctggtcgataccagccgagtcctggtctatggcctgagcgccgccgatgccctg
gccggtgctccccctgccctgctcgccagtgccattatcgccgccgcccttggggtggcg
gtgggaacccgggtggtggggaaaatgacggaccaagcggtccatacggtgacccggggg
cttttggtggtttttggcgggcttttgtgtgttggagtcctttag

DBGET integrated database retrieval system