KEGG   Rickettsia prowazekii NMRC Madrid E: H374_6850Help
Entry
H374_6850         CDS       T02544                                 

Definition
(GenBank) Penicillin-binding protein dacF
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rpn  Rickettsia prowazekii NMRC Madrid E
Pathway
rpn00550  Peptidoglycan biosynthesis
rpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H374_6850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rpn01002]
    H374_6850
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpn01011]
    H374_6850
Enzymes [BR:rpn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     H374_6850
Peptidases [BR:rpn01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   H374_6850
Peptidoglycan biosynthesis and degradation proteins [BR:rpn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   H374_6850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase CytoC_RC
Motif
Other DBs
NCBI-GeneID: 15150472
NCBI-ProteinID: AGJ01970
LinkDB All DBs
Position
complement(816898..817818)
Genome map
AA seq 306 aa AA seqDB search
MFRRFLLPYIFILIFCFAPISEAKKIVKNTNKHPIQTSLVIDAKNGKVLQAHNAQVRIYP
ASLTKLMTLYLIFEAIESRKLSLDKKLLVSAKASKMPHCKLGLRAGDHITVREAINGLII
KSANDVAVTVAEGMKGSEKAFAHLMNVRAKTLGMKNTFFKNASGLHDPFQQTTARDIAKL
AIALKRDYPKYYPLFSKTHFVFRGNVVNGHNSVTKHYQGAEGMKTGFHTPAGYNLVTTAS
RNNKSLIAVITGGKSAASRDQKMMRLLDHHFGVKTITSKPSIKLASNNKANTKAKSKIIK
RKNIRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagatttttactaccttatatctttattttaatattttgctttgctcctata
agcgaagcaaaaaaaattgtaaaaaataccaataaacatcctatccaaactagtttagta
attgacgcaaaaaatggtaaagttttgcaagcacataatgcacaagtgcgaatttatccc
gcttctttaactaagttaatgactctatatttaatatttgaagcaattgaatcacgtaag
ttatctttagataaaaaattacttgtatcggcaaaagcttcaaaaatgccgcattgtaaa
cttggtttaagagcaggtgaccatataaccgttagagaggcaattaatggattaataata
aaatctgctaatgatgttgcagtaactgttgctgagggtatgaaaggttcagaaaaagct
tttgctcatttaatgaatgtgagagctaaaacattaggtatgaaaaacacattttttaaa
aatgcttcaggtttgcatgatccatttcaacaaactaccgcaagagatatagctaaactc
gctattgcacttaaaagagattaccccaaatattatccattattttctaaaactcatttt
gtatttcgtgggaatgtagtaaacggacataatagtgttactaaacattatcaaggtgct
gaaggtatgaaaacaggatttcatactcctgcaggttataatttagtaacaactgcttct
cggaataataaatcattgattgcagttattactggcggtaaaagtgcagcatctcgtgat
caaaaaatgatgaggttattagatcaccattttggtgttaaaactataacttctaagcct
tcaatcaaacttgcctctaataataaagctaatacaaaagcgaaatcaaaaataataaag
agaaagaatatacgtagttga

DBGET integrated database retrieval system