KEGG   Rodentibacter pneumotropicus: NCTC8284_00248
Entry
NCTC8284_00248    CDS       T05800                                 

Gene name
atpA
Definition
(GenBank) ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00190  Oxidative phosphorylation
rpne01100  Metabolic pathways
Module
rpne_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC8284_00248 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:rpne00194]
    NCTC8284_00248 (atpA)
Enzymes [BR:rpne01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     NCTC8284_00248 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     NCTC8284_00248 (atpA)
Photosynthesis proteins [BR:rpne00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   NCTC8284_00248 (atpA)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase ATPase_2
Other DBs
NCBI-ProteinID: VEH65113
UniProt: A0A3S4TSX7
LinkDB
Position
1:149656..151197
AA seq 513 aa
MQLNSTEISELIKKRIAQFDVVSEAHNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY
AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLLGRVVNTLGQPIDGKGE
IENDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI
DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIVVAASASESAALQYLAPY
AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER
AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF
NSGIRPAVNPGISVSRVGGAAQTKVVKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ
LSHGEKVTELLKQKQYAPLSVAEQSVLLFAVEFGYLEDVELQKIASFETALLDYSHRNHG
DFMAELTKTGNYNDEIKDTLKTILDSFKTNSAW
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcaactaaattcaactgaaattagtgaattgattaaaaaacgaattgctcagtttgat
gtagtgagtgaagctcataacactgggacaattgtttccgtaagtgacggtattattcgt
attcacggtttgagcgatgtaatgcaaggggagatgatcgcattaccaggaaatcgctat
gcaatggctcttaaccttgagcgtgactcggtaggtgcggttgtaatgggtccttatgca
gatttagcggaaggaatggaagttcaatgtaccggtcgtattttagaagtgccggtaggt
cgtggcttgttaggtcgtgttgtcaatacactcggtcaaccgattgacggtaaaggtgaa
attgaaaatgacggattttcaccggttgaagttattgcaccgggcgttattgagcgtaaa
tcggtagatcaaccggtacaaaccggttacaaagcggtagactctatggtaccgattggt
cgaggtcagcgtgagttgatcattggagaccgtcaaacgggtaaaacagcattagcgatc
gatgcaattatcaatcagcgtgattctggtattaaatgtatctatgttgcaattggtcaa
aaagcatcaactatcgcaaacgtagtgcgtaaattagaagaacatggtgcattggcaaat
actatcgtggttgctgcgtcagcatctgaatctgccgcattacaatatcttgctccttat
gccggctgtgctatgggggaatatttccgtgatcgtggtgaagatgcgttaattgtttat
gatgatttatcaaaacaagcagtagcttaccgtcaaatttcattattactacgtcgtcca
ccgggtcgtgaagcttaccctggagatgttttctatttacattcacgcttacttgagcgt
gctgcacgtgttaatgaagaatatgtagaaaaatttaccaatggtgaagtaaaagggaaa
acaggttctttaactgctcttcctattattgaaactcaagcaggtgatgtttctgcattc
gtaccaaccaacgtaatttccatcaccgatggtcagattttcttagaatctaacttgttt
aactcaggtattcgccctgcagtaaacccaggtatttcggtatctcgtgtaggtggtgcg
gcacaaactaaagtggtgaaaaaattagcaggtggtattcgtaccgcattggcgcaatat
cgtgaattggccgcatttgctcaatttgcctctgatcttgatgatgcaacccgtaaacag
ctttctcacggtgaaaaagtcaccgagttattgaaacaaaaacaatatgcaccgcttagt
gttgcagagcaatctgtgttgctttttgctgttgagtttggttatttggaagacgtagaa
ctgcaaaaaattgcaagttttgagaccgcacttttagactattctcaccgtaaccatggc
gactttatggctgaattaaccaaaaccggtaattacaatgatgagataaaagacacattg
aaaacgattttggatagttttaagaccaatagtgcttggtaa

DBGET integrated database retrieval system