KEGG   Rodentibacter pneumotropicus: NCTC8284_01948
Entry
NCTC8284_01948    CDS       T05800                                 

Gene name
kdsA
Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00540  Lipopolysaccharide biosynthesis
rpne01100  Metabolic pathways
Module
rpne_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NCTC8284_01948 (kdsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rpne01005]
    NCTC8284_01948 (kdsA)
Enzymes [BR:rpne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     NCTC8284_01948 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:rpne01005]
 Lipid A
  NCTC8284_01948 (kdsA)
SSDB
Motif
Pfam: DAHP_synth_1 Cas_DxTHG
Other DBs
NCBI-ProteinID: VEH66768
UniProt: A0A3S4TVC1
LinkDB
Position
1:1196158..1197012
AA seq 284 aa
MQNKLVKIGHIEVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVTEKLNVPYVFKASFDK
ANRSSIHSYRGPGMEEGLKIFQELKTTFGVRIITDVHEIYQCQPVADVVDVIQLPAFLAR
QTDLVEAMARTGAVINVKKPQFLSPGQMGNIVEKIEECGNDKVILCDRGTNFGYDNLIVD
MLGFGVMKKVSKGNPVIFDVTHSLQCRDPFGAASGGRREQVTELARSGLAVGLAGLFLEA
HPNPNQAKCDGPSALPLSALEGFVSQMKAIDDLVKSFPELDTSI
NT seq 855 nt   +upstreamnt  +downstreamnt
atgcaaaataaacttgtaaaaattggtcacattgaggtggcaaatgacaaaccttttgta
ctttttggcggaatgaatgtacttgaaagtcgtgatatggcaatgcaagtgtgtgaagcc
tatgtgaaagtaaccgaaaaactcaatgtaccttatgtatttaaagcctcttttgacaaa
gccaatcgttcatctattcactcataccgtggaccgggtatggaagaaggcttaaaaatt
ttccaagaattaaaaactacatttggggtgagaatcatcacagatgttcatgaaatttat
caatgccagccggtggcggacgtggtagatgtgatccagctccctgcatttttagcccgt
caaacggatctggtggaagccatggcgcgtacaggagcggtgattaatgtgaaaaaacca
cagtttttaagtccgggtcaaatgggaaatattgtggaaaaaatcgaagaatgtggtaat
gataaagttattctttgcgatcgcgggacaaattttggctatgataatttaatcgttgat
atgcttggtttcggcgtgatgaaaaaagtatcaaaaggtaatcctgtgatttttgatgta
acccattcactacaatgtcgtgatccgtttggtgcggcatcgggcggtcgccgtgagcaa
gtgacggagcttgctcgttcaggtttagcggtggggcttgccggtttatttttagaagcg
catccgaatccgaatcaagcaaaatgtgatggtccatcagccttaccgttgtctgctttg
gaaggttttgtctcacaaatgaaagccattgacgatttagtcaaatctttccctgaattg
gatacgtcaatttaa

DBGET integrated database retrieval system