KEGG   Rodentibacter pneumotropicus: NCTC8284_02008
Entry
NCTC8284_02008    CDS       T05800                                 

Gene name
dapB
Definition
(GenBank) dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00261  Monobactam biosynthesis
rpne00300  Lysine biosynthesis
rpne01100  Metabolic pathways
rpne01110  Biosynthesis of secondary metabolites
rpne01120  Microbial metabolism in diverse environments
rpne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NCTC8284_02008 (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    NCTC8284_02008 (dapB)
Enzymes [BR:rpne01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     NCTC8284_02008 (dapB)
SSDB
Motif
Pfam: DapB_C DapB_N Semialdhyde_dh gerPA
Other DBs
NCBI-ProteinID: VEH66828
UniProt: A0A448MNU9
LinkDB
Position
1:1232310..1233122
AA seq 270 aa
MTLKIAIVGAGGRMGRQLIQAVHSTEGVELGAAFERKGSSLVGADAGELAGIGNLGVTVS
EDLVVQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFDDAGKAAIQSAAEKIAI
VFASNFSVGVNLVFKLLEKAAKVMGDYCDIEIIEAHHRHKVDAPSGTALSMGEHIAKTLG
RDLKTHGVFCREGITGERKPDEIGFSTIRASDVVGEHTVWFADIGERVEISHKASSRMTF
ANGAVRAGKWLENKPYGLFDMTDVLDLNNL
NT seq 813 nt   +upstreamnt  +downstreamnt
atgacattgaaaattgcgattgtcggtgccggtggaagaatggggcgtcaattaattcaa
gcggttcattctacggaaggcgttgaattgggggcggcttttgaacgcaaaggttcatca
ttagtgggagcggatgctggggaacttgcggggattgggaatcttggggttacagtatct
gaggatctagtcgttcaaaaagacaagtttgatttattgatcgatttcactcgtccggaa
ggtacgcttgaacacatcgcattttgtgtagcaaataataaaaaaatggtgattggtaca
acaggatttgatgacgcaggtaaagctgccattcaatctgccgctgaaaaaatcgccatt
gtttttgcctctaatttcagtgttggagtgaatttggtgttcaaacttttggaaaaagct
gccaaagtgatgggggattattgcgatattgaaattattgaagcacaccatcgccataaa
gtggatgctccttcaggcacagcgctctcaatgggagaacatattgcgaaaaccttagga
cgtgatttgaaaacccatggtgtattttgccgtgaaggcattacaggcgaacgtaaaccg
gatgaaatcggtttttccacaatccgagcctctgatgtggtgggcgagcataccgtatgg
tttgcggacattggcgagcgggtggaaatttcccacaaagcctcaagccgaatgaccttt
gcaaacggtgcagtgcgggcaggaaaatggttggaaaataagccctatggtttatttgat
atgacggatgtattggatttgaataatttataa

DBGET integrated database retrieval system