KEGG   Rodentibacter pneumotropicus: NCTC8284_02635Help
Entry
NCTC8284_02635    CDS       T05800                                 

Gene name
fabI_1
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00061  Fatty acid biosynthesis
rpne00780  Biotin metabolism
rpne01100  Metabolic pathways
rpne01130  Biosynthesis of antibiotics
rpne01212  Fatty acid metabolism
Module
rpne_M00083  Fatty acid biosynthesis, elongation
rpne_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC8284_02635 (fabI_1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC8284_02635 (fabI_1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NCTC8284_02635 (fabI_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpne01004]
    NCTC8284_02635 (fabI_1)
Enzymes [BR:rpne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NCTC8284_02635 (fabI_1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NCTC8284_02635 (fabI_1)
Lipid biosynthesis proteins [BR:rpne01004]
 Fatty acid synthase
  Component type
   NCTC8284_02635 (fabI_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2
Motif
Other DBs
NCBI-ProteinID: VEH67449
UniProt: A0A3S4Y2Q0
LinkDB All DBs
Position
1:1593319..1593462
Genome map
AA seq 47 aa AA seqDB search
MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNENYNRV
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttaacaggtaaacgaattttagtcaccggtcttgcaagcaatcgttctatt
gcttacgggattgcaaaatcaatgaaagaacagggcgcagagcttgcgttcacttattta
aacgaaaattacaaccgcgtgtag

DBGET integrated database retrieval system