KEGG   Rodentibacter pneumotropicus: NCTC8284_02833
Entry
NCTC8284_02833    CDS       T05800                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-ACP synthase
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00061  Fatty acid biosynthesis
rpne00780  Biotin metabolism
rpne01100  Metabolic pathways
rpne01212  Fatty acid metabolism
rpne01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC8284_02833 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC8284_02833 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpne01004]
    NCTC8284_02833 (fabB)
Enzymes [BR:rpne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     NCTC8284_02833 (fabB)
Lipid biosynthesis proteins [BR:rpne01004]
 Fatty acid synthase
  Component type
   NCTC8284_02833 (fabB)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Other DBs
NCBI-ProteinID: VEH67636
UniProt: A0A3S4UAH7
LinkDB
Position
1:complement(1711527..1712723)
AA seq 398 aa
MKRAVITGFGIISSIGNNKEEVLASLKAGKSGIEIVPEFVEMKMRSHVAGTIKLDPSEHI
DRKVYRFMGDAAAYAYLSMREAIEDSGLTEEQVSNDRTGLVIGAGTGSAHNQLIACDAAR
GPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVSYSISSACATSAHCIGHALELIQLGK
QDVVFAGGAEELSWECATEFDAMGAVSTKYNDTPEKASRAYDANRDGFVIAGGGAVVVVE
ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMKQAMATVDAPIDYINVHGTS
TPVGDVKELGAIKAVFGAKTPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI
ETLDEAAEGCNIVTETKENAGLQTVMSNSFGLVVRMRR
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaaaagagctgtcattacaggctttggtattatttccagtatcggcaacaataaagaa
gaagtgcttgcctcgctaaaagcgggaaaatcgggtattgaaattgtgcctgaatttgtt
gaaatgaaaatgcgtagtcatgttgcaggcacgattaaattggatccaagtgaacatatt
gatcgtaaagtgtatcgtttcatgggtgatgcggcggcttatgcttacctttctatgcgt
gaagctattgaagattcgggtttaacggaagagcaggtttccaatgatcgtaccggttta
gtcatcggggcaggtacagggtctgcacataatcaattaattgcttgtgatgcggcacgt
ggtcctcgtggtgtgaaggcaatcgggccttatgcggtaacgaaaaccatggcatcaagt
gtttcagcctgtcttgctacgccttacaaaatccgtggtgtcagctactcgattagttcc
gcttgtgcgacttcggcacattgtattggtcatgcactggaattaattcaattaggcaag
caagatgtggtgtttgccggcggtgcggaagaattatcttgggaatgtgccacagaattt
gatgcaatgggagccgtttccacgaaatataatgatacgccggaaaaagcttctcgtgct
tacgatgctaatcgtgatggtttcgttattgccggtggcggtgcagttgtggtggtggaa
gaattagaacacgcccttgctcgcggtgcaaaaatttatgcggaaattgtgggttatggt
gcgacttctgacggctatgatatggtcgcaccaagcggtgaaggtgcggaacgctgcatg
aaacaagccatggcgacagtggacgcaccaattgattatattaatgttcacggcacctca
acaccggtcggtgatgtgaaagagttgggtgcaatcaaagcagtcttcggagcaaaaact
ccggcaatttcttcaacgaaatcaatgaccggtcactctttaggggctgcaggtgcgcat
gaagcgatttataccttattaatgcttgataatgatttcatcgcgccaagcattaatatt
gaaaccttagatgaagcagcggaaggttgcaatatcgtgacagaaaccaaagaaaatgcc
ggcttgcaaactgtgatgtcaaacagcttcggtttggtggtacgaatgcgacgttaa

DBGET integrated database retrieval system