KEGG   Rodentibacter pneumotropicus: NCTC8284_02939Help
Entry
NCTC8284_02939    CDS       T05800                                 

Gene name
mrcB_1
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC8284_02939 (mrcB_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rpne01003]
    NCTC8284_02939 (mrcB_1)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpne01011]
    NCTC8284_02939 (mrcB_1)
Enzymes [BR:rpne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NCTC8284_02939 (mrcB_1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NCTC8284_02939 (mrcB_1)
Glycosyltransferases [BR:rpne01003]
 Polysaccharide
  Bacterial polysaccharide
   NCTC8284_02939 (mrcB_1)
Peptidoglycan biosynthesis and degradation proteins [BR:rpne01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NCTC8284_02939 (mrcB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: VEH67732
UniProt: A0A448MRF3
LinkDB All DBs
Position
1:1773637..1774311
Genome map
AA seq 224 aa AA seqDB search
MFLLKSSFTVAVLAIFYGGYLDWQIRSKMDGQIWHLPAEVYSRIESVKITDNLAFDEVIQ
ILLNNEYRQTTMVAAPGDFKLEDDTIVVLRRAFPFPDKPEPQRVLRLRFTDNKLSRIEDL
VALQAIDEFRLAPKLIAMLASDNEDRLAIPLQNYPRLLIDTLILTEDRRFYEHNGINPVG
IVRALIANIRAGQTVQGGSTLTQQLVKNLFYQANVPLHAKPTRL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtttctactcaaaagcagcttcactgtagcagtactggcaatattttatggcggctac
ttagattggcaaattcgttccaaaatggacgggcaaatttggcatttaccggcagaagta
tatagccgcattgaaagtgtcaaaattaccgataatcttgcttttgacgaagtcattcaa
attttacttaataacgaataccgtcaaactaccatggttgcagcaccgggtgattttaag
ttagaagatgatacaatcgttgttctacgtcgtgcttttcctttccccgataaacctgaa
cctcagcgggtattacgcctacgttttactgataataaattaagccgaattgaagatctt
gttgcccttcaagctattgatgaatttcgcctagcccctaaacttatcgcaatgttggca
tcagataacgaagatcgtcttgcgattcccctgcaaaattaccctcgtttattgatcgat
acactgattttaacagaggatcgccgtttttatgagcataacggaattaatcccgttgga
attgtacgcgcattaattgcaaatatccgtgccggacaaaccgttcaaggtggcagtaca
ttaacgcaacaattagtcaaaaaccttttttatcaagcgaacgtaccattacacgcaaag
ccaacgaggctttaa

DBGET integrated database retrieval system