KEGG   Rodentibacter pneumotropicus: NCTC8284_03142Help
Entry
NCTC8284_03142    CDS       T05800                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00471  D-Glutamine and D-glutamate metabolism
rpne00550  Peptidoglycan biosynthesis
rpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NCTC8284_03142 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC8284_03142 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpne01011]
    NCTC8284_03142 (murC)
Enzymes [BR:rpne01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     NCTC8284_03142 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:rpne01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC8284_03142 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: VEH67927
UniProt: A0A3S4VFQ6
LinkDB All DBs
Position
1:complement(1899332..1900759)
Genome map
AA seq 475 aa AA seqDB search
MKHSHEEIRKIIPEMRRVQQIHFIGIGGAGMSGIAEILLNEGYRISGSDIADGVVTQRLV
QAGATVFIGHAAENIDGASVVVVSSAIREDNPELVAAQQNRIPVIQRAQMLAEIMRFRHG
IAVAGTHGKTTTTAMLSMIYTQAKLDPTFVNGGLVKSAGKNAHLGVSRYLIAEADESDAS
FLHLQPMVSVVTNIEPDHMDTYEGDFEKMKATYVKFLHNLPFYGLVVMCADDSVLMELAP
KVGRQVITYGFSEEADYRIEDYEQIGFQGHYRVICPNGECINVLLNVPGKHNALNATAAL
AVAKEEGINNEAILEALADFQGAGRRFDQLGEFIRPNGKVRLVDDYGHHPTEVGVTIQAA
REGWGDKRIVMIFQPHRYSRTRDLFDDFVQVLSQVDALVMLDVYAAGETPIVGADSKALC
RSIRNLGKVDPILVSDTMQLGEVLDQIIQDGDLILAQGAGSVSKISRNLADSWKN
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattctcacgaagaaattagaaaaattatccctgaaatgcgtcgggttcagcaa
attcattttattggtatcggcggtgccggtatgagcggtattgcagaaattcttttgaat
gaaggctatcgaatttcaggttcggatattgcagatggcgtagttacccaacgtcttgta
caggcaggcgcgacagtttttattggtcatgcagctgaaaatattgatggcgcgagtgtt
gttgtggtatcaagtgctattcgtgaagataatcctgaattagttgcggcacaacaaaat
cggattccagtgatccagcgtgcacaaatgttggcggaaattatgcgttttcgccacggc
attgcggtagccggaacccatggtaaaacaacaacaacggcaatgctgtcgatgatttat
acgcaagcaaaattagatcctacgtttgtaaatggagggttagtaaaatcagcgggaaaa
aatgcccatcttggggtgagtcgttatttgatcgcagaagcagatgaaagcgatgcctct
ttcttgcatttacagcccatggtttctgttgtgacgaatattgagccggatcacatggac
acttatgaaggtgatttcgaaaaaatgaaagccacctatgtgaaattccttcataatctg
ccgttttacggcttagtggtaatgtgtgccgatgattctgtgttgatggaattagcgccg
aaagtggggcgtcaggttattacttacggctttagtgaagaggctgattatcgtattgaa
gattatgagcaaatcggttttcaggggcattacagagtaatttgtccaaatggggaatgc
attaatgtgctgctaaatgtgcctggcaaacacaatgcgttaaacgccactgcggcattg
gctgtcgccaaagaagagggaattaataacgaagcgatcttggaagcacttgccgatttc
caaggtgccggacgtcgttttgatcaacttggtgagtttattcgcccgaatggaaaagtg
cgtttagtcgatgattatggccatcatccaactgaagtaggggtaactattcaagcggct
cgtgaaggttggggagataaacgtattgtgatgattttccaaccgcatcgttattcccgt
acccgtgatttatttgatgattttgtacaggtactttcacaagtggatgcacttgttatg
ttggatgtttatgctgccggtgaaacgccgattgtaggggctgacagtaaagcactctgc
cgttcaatccgtaatttggggaaagtcgatcctattttggtatcggatacgatgcaatta
ggggaagtgctagatcaaattattcaagacggtgatttaattttggcgcaaggtgcgggg
agcgtgagtaagatctctcgtaatttggctgattcttggaagaattag

DBGET integrated database retrieval system