KEGG   Rodentibacter pneumotropicus: NCTC8284_03742
Entry
NCTC8284_03742    CDS       T05800                                 

Gene name
lpxA
Definition
(GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00540  Lipopolysaccharide biosynthesis
rpne01100  Metabolic pathways
rpne01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NCTC8284_03742 (lpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NCTC8284_03742 (lpxA)
Enzymes [BR:rpne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     NCTC8284_03742 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:rpne01005]
 Lipid A
  NCTC8284_03742 (lpxA)
SSDB
Motif
Pfam: Acetyltransf_11 Hexapep Hexapep_2
Other DBs
NCBI-ProteinID: VEH68508
UniProt: A0A1V3K0T2
LinkDB
Position
1:complement(2287738..2288526)
AA seq 262 aa
MIHSSAKIHPTALVEEGAIIGEDVVIGPFCIVEGSVEIKARTVLKSHVVVRGDTVIGEDN
EIYQFATIGEVNQDLKYKGEATKTIVGNANRIREHVTIHRGTIQGGGVTRIGNNNLLMIN
VHVAHDCQIKNNCILANNATLAGHVELDDFVIVGGMSAIHQFVVVGAHVMLGGGSMVSQD
VPPYVMAQGNHARPFGVNLEGLKRRGFDKPTMHAIRNIYKMIYRSGKTLEEIIPEIEQIA
ETDSAISFFTNFFKRSTRGIIR
NT seq 789 nt   +upstreamnt  +downstreamnt
atgattcactcaagtgcaaaaatccacccgacagcattagttgaagaaggggctatcatt
ggtgaggatgtggtaattggtcctttctgtattgttgaaggttctgttgagattaaagca
cgcaccgtgttgaaatcacacgtggtagtacgtggcgatacagtgattggtgaggataac
gaaatttatcaatttgcaacgattggcgaagtcaaccaggatttaaaatacaaaggtgag
gcgacaaaaaccattgttggtaatgctaatagaattcgcgaacatgtgacgattcatcgg
gggactatccaaggtggtggcgtaacccgtatcggtaataataatcttctgatgattaac
gtacacgttgcgcatgattgccaaatcaaaaataattgtatcttagccaataatgccacc
cttgccggtcatgttgaattagatgattttgtaattgttggcggtatgtctgccattcat
caatttgtggttgtaggggctcacgtaatgttaggcggtggttcaatggttagccaagat
gtaccgccttatgtgatggcgcaaggcaatcatgcccgtccgtttggcgtgaatttagaa
ggcttaaaacgccgtggatttgataaaccgacgatgcacgcaattcgtaatatatataag
atgatctaccgtagcggtaaaacgcttgaggaaattattccggaaattgaacaaattgct
gaaaccgattccgctatcagtttctttaccaatttcttcaaacgatcaacccgcggaatt
attcgttaa

DBGET integrated database retrieval system