KEGG   Rodentibacter pneumotropicus: NCTC8284_03744
Entry
NCTC8284_03744    CDS       T05800                                 

Gene name
lpxD_1
Definition
(GenBank) UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
  KO
K02536  UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC:2.3.1.191]
Organism
rpne  Rodentibacter pneumotropicus
Pathway
rpne00540  Lipopolysaccharide biosynthesis
rpne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpne00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NCTC8284_03744 (lpxD_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:rpne01005]
    NCTC8284_03744 (lpxD_1)
Enzymes [BR:rpne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.191  UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
     NCTC8284_03744 (lpxD_1)
Lipopolysaccharide biosynthesis proteins [BR:rpne01005]
 Lipid A
  NCTC8284_03744 (lpxD_1)
SSDB
Motif
Pfam: Hexapep Hexapep_2
Other DBs
NCBI-ProteinID: VEH68510
UniProt: A0A448MTL8
LinkDB
Position
1:complement(2289084..2289683)
AA seq 199 aa
MLCGKNTKIATGTQLWANVTVYHDVEIGSNCLIQSGAVIGSDGFGYANDRGRWIKIPQVG
QVIIGNNVEIGACTCIDRGALDATVIEDNVIIDNLCQIAHNVYIGTGTAVAGGVIMAGSL
TVGRYCLIGGASVINGHMEICDKVTITGMGMVMRPITEPGIYSSGIPLQTNKEWRKTAAL
TLGIDGMNKRLKALEKKIS
NT seq 600 nt   +upstreamnt  +downstreamnt
ttgctttgtgggaaaaacacaaaaattgctaccggtacgcaactttgggcgaatgtgacc
gtttatcatgatgtagaaattggttcaaactgtttaattcaatccggtgcggtaattggt
agtgatggttttggttatgcgaatgatcgcggtcgttggattaaaattccacaagtgggt
caagttattatcggtaacaatgttgaaatcggcgcttgtacttgtatcgatcggggcgca
ttagatgcaacagtgatcgaagataatgtgattatcgataatctttgtcaaattgcccat
aatgtttacattggcacaggtacggcggtagcaggcggtgtgattatggcggggagtctg
actgtagggcgttattgccttatcggtggcgcgagtgtgatcaacggccatatggaaatc
tgtgacaaagtgacgattaccggcatgggaatggtgatgcggccaattaccgaaccaggg
atttattcttccggtattccgttgcaaaccaataaagagtggcgtaaaacagcggcactg
actttggggattgatggaatgaataagcgtttaaaagcacttgaaaagaaaatcagttaa

DBGET integrated database retrieval system