KEGG   Rickettsia prowazekii BuV67-CWPP: MA1_01885Help
Entry
MA1_01885         CDS       T01788                                 

Definition
(GenBank) penicillin-binding protein DACF precursor (dacF)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rpo  Rickettsia prowazekii BuV67-CWPP
Pathway
rpo00550  Peptidoglycan biosynthesis
rpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MA1_01885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rpo01002]
    MA1_01885
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpo01011]
    MA1_01885
Enzymes [BR:rpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MA1_01885
Peptidases and inhibitors [BR:rpo01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   MA1_01885
Peptidoglycan biosynthesis and degradation proteins [BR:rpo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   MA1_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase CytoC_RC
Motif
Other DBs
NCBI-ProteinID: AFE50893
LinkDB All DBs
Position
477722..478642
Genome map
AA seq 306 aa AA seqDB search
MFRRFLLPYIFILIFCFAPISEAKKIVKNTNKHPIQTSLVIDAKNGKVLQAHNAQVRIYP
ASLTKLMTLYLIFEAIESRKLSLDKKLLVSAKASKMPHCKLGLRAGDHITVREAINGLII
KSANDVAVTVAEGMKGSEKAFAHLMNVRAKTLGMKNTFFKNASGLHDPFQQTTARDIAKL
AIALKRDYPKYYPLFSKTHFVFRGNVVNGHNSVTKHYQGAEGMKTGFHTPAGYNLVTTAS
RNNKSLIAVITGGKSAASRDQKMMRLLDHHFGVKTITSKPSIKLASNNKANTKAKSKIIK
RKNIRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagatttttactaccttatatctttattttaatattttgctttgctcctata
agcgaagcaaaaaaaattgtaaaaaataccaataaacatcctatccaaactagtttagta
attgacgcaaaaaatggtaaagttttgcaagcacataatgcacaagtgcgaatttatccc
gcttctttaactaagttaatgactctatatttaatatttgaagcaattgaatcacgtaag
ttatctttagataaaaaattacttgtatcggcaaaagcttcaaaaatgccgcattgtaaa
cttggtttaagagcaggtgaccatataaccgttagagaggcaattaatggattaataata
aaatctgctaatgatgttgcagtaactgttgctgagggtatgaaaggttcagaaaaagct
tttgctcatttaatgaatgtgagagctaaaacattaggtatgaaaaacacattttttaaa
aatgcttcaggtttgcatgatccatttcaacaaactaccgcaagagatatagctaaactc
gctattgcacttaaaagagattaccccaaatattatccattattttctaaaactcatttt
gtatttcgtgggaatgtagtaaacggacataatagtgttactaaacattatcaaggtgct
gaaggtatgaaaacaggatttcatactcctgcaggttataatttagtaacaactgcttct
cggaataataaatcattgattgcagttattactggcggtaaaagtgcagcatctcgtgat
caaaaaatgatgaggttattagatcaccattttggtgttaaaactataacttctaagcct
tcaatcaaacttgcctctaataataaagctaatacaaaagcgaaatcaaaaataataaag
agaaagaatatacgtagttga

DBGET integrated database retrieval system