KEGG   Roseitalea porphyridii: E0E05_00500Help
Entry
E0E05_00500       CDS       T05862                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rpod  Roseitalea porphyridii
Pathway
rpod00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpod01100  Metabolic pathways
rpod01110  Biosynthesis of secondary metabolites
rpod01130  Biosynthesis of antibiotics
rpod01230  Biosynthesis of amino acids
Module
rpod_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    E0E05_00500
Enzymes [BR:rpod01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     E0E05_00500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_33 AAA_18 TsaE AAA_16 RsgA_GTPase AAA_22 CoaE AAA AAA_5 dNK
Motif
Other DBs
NCBI-ProteinID: QBK29203
UniProt: A0A4P6UXH7
LinkDB All DBs
Position
109105..109701
Genome map
AA seq 198 aa AA seqDB search
MTEQSTDMAGEVAARLNGRPIVLIGMMGAGKSAIGRKLAARLDWPFVDADHEIEAAANMS
IPDIFEAYGEPEFRRLEASVMARLLDAGSSVLATGGGAFMNADTRAAIAASAVSVWLSAD
IDLLMARVARKSTRPLLKAPDPRAVMQKLIDERYPVYARADVTVASRDASKEEMAQTVIE
ALHDHLAGTPEKAAQDPT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaatcgaccgacatggccggcgaggtcgccgcgcgccttaatggcaggccg
atcgtgctgatcggcatgatgggcgccggcaagtcggcgatcggccgcaagctggccgcc
cggctcgactggccgttcgtcgatgccgaccacgagatcgaggcggcggccaacatgtcg
attcccgatatcttcgaggcctatggcgagccggagttccgtcgcctcgaggccagcgtg
atggcccggttgctcgacgccggatcctcggtgctggcgaccggaggcggagccttcatg
aacgccgatacgcgcgcggccatcgccgcgtcggccgtctcggtctggctgtcggccgac
atcgatcttctgatggcccgcgtcgcccgcaagtcgacccgtcccttactgaaggcgccc
gacccgcgcgccgtcatgcagaagctcatcgacgagcgctatccggtctacgcccgggcc
gacgtcaccgtggcctcgcgcgatgccagcaaggaggagatggcccagaccgtgatcgag
gcgttgcacgaccatctggccggcacgcccgaaaaggccgcacaggacccgacatga

DBGET integrated database retrieval system