KEGG   Roseitalea porphyridii: E0E05_04055Help
Entry
E0E05_04055       CDS       T05862                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
rpod  Roseitalea porphyridii
Pathway
rpod02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    E0E05_04055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpod02000]
    E0E05_04055
Transporters [BR:rpod02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    E0E05_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA
Motif
Other DBs
NCBI-ProteinID: QBK32243
UniProt: A0A4P6V5N4
LinkDB All DBs
Position
847296..848156
Genome map
AA seq 286 aa AA seqDB search
MLGLLGESGCGKTITALSVLGLLPKHAVRVTGGRILFEGRDIADLGEDELNRIRGNRIAM
IFQEPMTSLNPIMTIGAQIGEALQIHRRMPAASRRAEIKRLLGLVGLPSEDAQLDRYPFQ
LSGGQRQRVMIAIALACEPALLIADEPTTALDVTIQAQILDLIAEMRRRFGMACVMVTHD
LGVVAETCDRAIVMYAGRVAEEGPVDELFGAPIHRYTEALVGTIPAANPPGARLPAIPGA
VPPPGDRPAGCAFAGRCDHALDVCASRPPPEVRRGAHVGYCWNPAS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctcggattgctcggcgagtcgggctgcggcaagacgatcacggcgctgtcggtgctc
ggcctcctgcccaaacatgccgtccgtgtcaccggcggccggatcctgttcgagggcagg
gacatcgccgaccttggcgaggacgaactcaaccgcatccgcggcaaccgcatcgccatg
atcttccaggagccgatgacctcgctcaatccgatcatgacgatcggcgcgcagatcggc
gaggcgctgcagatccaccggcgcatgccagcagcgagccgcagggccgagatcaagcgg
ctgctgggactggtcggcctgccgagcgaggacgcgcaactggaccgctatccgttccag
ctttcgggtggacagcgccagcgcgtgatgatcgcgatcgcgctcgcctgcgagccggcc
cttctgatcgccgacgagccgacgaccgcgctcgacgtgacgattcaggcgcagatcctc
gacctcatcgccgagatgcggcggcgcttcgggatggcctgcgtgatggtcacccacgac
ctcggcgtcgtcgccgagacctgcgaccgcgcgatcgtcatgtatgccgggcgcgtcgcc
gaggagggcccggtggacgaactgttcggcgcgccgatccaccgctacaccgaggcgctg
gtcggcaccattcccgccgccaatccgcccggcgcgcgcctaccggcgatcccgggcgcc
gtgccgccgccgggtgaccggccggccggctgcgccttcgccggccgctgcgaccacgcg
ctcgatgtctgtgccagccggccgccgccggaagtgcgccgcggcgcccatgtcggctat
tgctggaaccccgcgtcatga

DBGET integrated database retrieval system