KEGG   Roseitalea porphyridii: E0E05_13245
Entry
E0E05_13245       CDS       T05862                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rpod  Roseitalea porphyridii
Pathway
rpod00473  D-Alanine metabolism
rpod00550  Peptidoglycan biosynthesis
rpod01100  Metabolic pathways
rpod01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rpod00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    E0E05_13245
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E0E05_13245
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    E0E05_13245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpod01011]
    E0E05_13245
Enzymes [BR:rpod01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     E0E05_13245
Peptidoglycan biosynthesis and degradation proteins [BR:rpod01011]
 Precursor biosynthesis
  Amino acid ligase
   E0E05_13245
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST
Other DBs
NCBI-ProteinID: QBK31489
UniProt: A0A4P6V404
LinkDB
Position
complement(2730399..2731325)
AA seq 308 aa
MSKKHVAVLMGGFSSERPVSLASGGECAAELERAGYPVTRVDVDRNLSARLAELRPDVVF
NALHGPYGEDGTVQGILEYLQIPYTHSGVLASAVTMDKDLSKRLAKTFGIPVAESKVMDR
HQIGSRHPMQPPYVVKPVAEGSSFGVVIVDANQSHPPQIITSDEWAYGDRVMVERYVHGR
ELTCAVMGDVALGVTEIIPQGHAFYDYDSKYVPGGSKHVCPAEISPNIYQQVTKLALKAH
QAFGCRGVTRSDFRYDDRFSENGELIWLEINTQPGMTATSLVPEIALAAGHSFAELLEWM
VEDASCMR
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagcaagaaacacgtcgccgtgctgatgggcggcttttcgtcggaacggccggtgagc
ctggcctcgggcggcgaatgcgcggccgagctcgaacgggccggctacccggtcacgcgc
gtcgacgtggaccggaacctgtcggcgcggctcgccgaactcaggcccgacgtcgtcttc
aacgcgctgcacggcccctatggcgaggacggcacggtgcagggcatcctcgaatatctg
cagatcccctacacccattcgggcgtgctcgcctcggcggtgacgatggacaaggacctg
tcaaagcggctggcgaagacgttcggcataccggtcgccgagtcgaaggtgatggaccgg
caccagatcggctcgcgccatccgatgcagccgccctacgtggtcaagccggtcgccgag
gggtcgagcttcggcgtcgtgatcgtcgacgccaaccagtcccatccgccgcagatcatc
acctcggacgaatgggcctatggcgaccgggtgatggtcgagcgctacgtgcacgggcgc
gagctgacctgtgccgttatgggcgacgtggcgctcggggtgaccgaaatcatcccgcag
ggacacgccttctacgactatgattccaaatatgttccgggcggttcaaaacatgtctgt
ccggcggaaatttcaccaaatatttaccaacaggtaacgaaactggcgctcaaagcacat
caggcattcggatgccggggcgtgacgcgttcggatttccgttatgacgaccggttctcg
gaaaacggagagctgatctggctggaaatcaacacgcaaccgggcatgaccgcgacgtca
ctggtcccggaaatcgcgctggcggccgggcactccttcgccgaactgcttgaatggatg
gtggaggacgcatcttgcatgcgttga

DBGET integrated database retrieval system