KEGG   Rickettsia parkeri: MC1_04815Help
Entry
MC1_04815         CDS       T01785                                 

Definition
(GenBank) penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
rpp  Rickettsia parkeri
Pathway
rpp00550  Peptidoglycan biosynthesis
rpp01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rpp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MC1_04815
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MC1_04815
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpp01011]
    MC1_04815
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rpp03036]
    MC1_04815
Enzymes [BR:rpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MC1_04815
Peptidoglycan biosynthesis and degradation proteins [BR:rpp01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   MC1_04815
Chromosome and associated proteins [BR:rpp03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    MC1_04815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer EVI2A
Motif
Other DBs
NCBI-ProteinID: AFC75040
LinkDB All DBs
Position
complement(841291..842973)
Genome map
AA seq 560 aa AA seqDB search
MKQIWEKWKPTIKSLTIWNVCSKNTKIRLLMVICVFSFLFCTLSYRLIIVATNVYDKNIN
SFKKNHQFRKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLA
ELKSNKSFIWVKRDVLPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVG
LSGLELAYDKYLTNSDYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGI
IADPNNGEILALVNKPDFDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAI
NMNDAYDISYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKK
LGLLDQLQIELPERGTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLY
DLTLLKRKDEKVIGTKVFSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLS
QGAGKKKYLKNSRASSFLGMLPASNPQYVIFIRFDEPKPTKESFGFATASWTAAPTAGRV
FERMISLYGLEPIEQSEEES
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatttgggaaaaatggaaacctacaattaaaagtctaacaatttggaatgtt
tgtagtaaaaatacaaaaatccgattattaatggttatttgtgtcttttcttttcttttt
tgtactttatcttacagattgataatcgttgctacgaatgtttacgataaaaatattaat
tcctttaaaaaaaatcatcaatttagaaaagaaatagttgatcgaaacggtaatttatta
gcagtgaacctaccttctgcctcattatttgctaatccacaaatagtacttgatcctgaa
acttccgtaaaaaagctagcagaaattctacctgatattaataaagctaaattacttgca
gaacttaagtcaaataaaagctttatatgggtaaaaagggatgtactacctagtcagcaa
gaaaagataactagccttgggttacttggttttgaatttgaagaagagcagaaacgaatt
tataccttttctaatttattgtcgcatgttgtcggttatgtaggtagagactcggtaggg
cttagtggtttagagctcgcttatgataagtatttaactaattctgattatgaattaaac
gaaccaaagaatcggaaagaaccgcttcaattatctattgatatcagattacaaagtatt
ttaagtgaggagattgataaaactttaaagcaatttaaggccataggagcagtaggtatt
attgctgatccaaataatggcgagattttagcattagtaaataagcctgatttcgatccg
cattatccgagtttagccaaaccggaagagctgtttaatatagcaagtctcgggatttac
gaaatgggttcggtgtttaaggcattaactatggcagtcggctttgataccggtgcaata
aatatgaatgatgcttatgatataagttatatgaaagtaggaggattccagcttaaggat
tatactccaaggcaaggatggcatagtgtacctgagatttttctatattcttcaaatatt
ggcacaagtcaaattatgcttgaaatcggtaaaagcaattttaaaaaatacctaaagaaa
ttaggtctattagatcagttgcaaatagaattacctgaacgaggtactccgttatttcct
tccgagaaaagatggaatgagttaacgagtgttactatgtcgtatggctacggcatttcg
attagccctttgcattttgttagagcaatgttaccggttgttaacggtggtactttatat
gatcttactttattaaaaagaaaggatgaaaaagtaataggtacaaaagtttttagtgaa
aatacctctacccaaatgaagaaattatttagagcggtagtaaaagaaggtaacggtaaa
agagcagaggtcaaaggctatcttatcggcggtaagaccggtacggcagaaaaactttca
caaggggcaggaaaaaagaaatatctaaaaaatagtagagcgtcatcgtttttaggtatg
ctgcctgcatctaacccgcaatatgttatttttattagatttgatgagccgaaaccgact
aaagaaagctttggctttgcaaccgcaagttggacggctgcccctactgccggtagagta
tttgaacgtatgatatctttatatggtttagaaccgatagaacaaagtgaggaagaaagt
taa

DBGET integrated database retrieval system