KEGG   Rickettsia prowazekii Madrid E: RP807Help
Entry
RP807             CDS       T00018                                 

Definition
(RefSeq) penicillin-binding protein 1A (mrcA)
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rpr  Rickettsia prowazekii Madrid E
Pathway
rpr00550  Peptidoglycan biosynthesis
rpr01100  Metabolic pathways
rpr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RP807
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RP807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rpr01003]
    RP807
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpr01011]
    RP807
Enzymes [BR:rpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     RP807
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RP807
Glycosyltransferases [BR:rpr01003]
 Polysaccharide
  Bacterial polysaccharide
   RP807
Peptidoglycan biosynthesis and degradation proteins [BR:rpr01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   RP807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-GeneID: 883908
NCBI-ProteinID: NP_221157
UniProt: Q9ZCE9
LinkDB All DBs
Position
complement(1015504..1017867)
Genome map
AA seq 787 aa AA seqDB search
MYKSLFLCLKIFAVLILIGCSVTAYIIYHYSHDLPDYSQLARYYPPSVTRIYSRDGKLIE
EYAFERRVFVPINNVPSSLIESFIAAEDKNFYTHPGIDLLGIVRAAFLNISNYLHNRRME
GASTITQQVVKNFLLTNEVSLERKIKEVIISYMISRIFTKHQILELYLNQTFFGRGAYGV
AAAAQNYFNKSVEELTIAESAFIAALPKAPSELNPDKNYSRVKARRDYVIERMFEDGYIT
RDTMKEAIGSPIVLRKRAKEETVTADYYAEQVREEVIRMLNSKEEFYRGGLTIITSLDAK
MQQLAENSLRKGLREFDRKSGFRKPIANIPLDNWQEELKKLPTPSSLLEYKLAVVLDVSD
NHAKIGLIDGSKAKIPIVEMQWARSNLKSVKTLLKKGDVIVVEPIKDCYALRQIPEVNGA
IMVMNPHTGQVLASVGGYDFSTSKFDRVTQALRQPGSLSKTFVYLAALENGVKPNQIFND
GPIEIIQGPGMPSWCPKNYEGQFLGDMTMRTGFEKSRNLITVRVATAVGLTKIVDIIKRF
GINNEPKKVYSMVLGSIETTLSRITNAYAIIANGGKKVEPHFVELIQDRNGKIIYRRDNR
ECFSCNIADSDLDTAILEIPKEDIYRVTDEASNYQITSFLTGAIDSGTGYAARKLGKIIA
GKTGTSNDSKDTWFIGFTPKIVVGSYVGYDTPKELGKKATGSNVVLPIFIDFMNHAYKDE
PSLPFKVPDSIKLIAVDRITGKMIPNGTVIEAFKVNNIQMLENDYMIDNHDIFDYVPGML
DQSQEIY
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaatcattatttttatgtttaaagatttttgccgttcttattttaataggttgt
tctgttactgcttatatcatatatcactattcacatgatttacctgattactcacagctt
gcacgttattatcctccatctgtaactcgtatttattctcgtgacggtaaattaattgag
gaatatgcttttgaacgccgagtatttgtacctattaataatgtaccgagttcattaata
gaaagttttattgcagctgaggataagaatttttatacccatccaggtatcgatttgctt
ggcatagttagagcagcatttttaaatatatctaattatttacataataggcgtatggaa
ggagcgtctacgattactcagcaagtggttaaaaattttttgctcactaatgaggtttct
cttgaacgtaagattaaagaagttatcatatcttatatgatttcgcgaatatttactaag
catcaaattttagaattataccttaatcaaacattctttggtcgtggtgcatacggtgtt
gcggcagctgcacaaaattattttaataaatctgtagaggaacttaccattgcagaatca
gcgtttattgcagcactgcctaaagctccttccgaacttaatccagataaaaactactct
agagtgaaagcgcgtcgcgattatgtaatagaacgtatgtttgaagatggttatatcaca
agagatactatgaaagaagctataggtagcccaatagttttacgtaaacgagctaaagaa
gaaactgttacagcagactattatgctgaacaggttcgagaagaagtgattaggatgtta
aatagtaaggaagaattttatagaggaggtcttactattattacttctttagatgcaaag
atgcagcaattagctgagaattctctaagaaaaggtctgagagagtttgatagaaaaagt
ggttttagaaagcctatcgctaatattcctcttgataattggcaagaggagctaaaaaaa
ctacctactccttcttctcttttagaatataaattagctgtagtcttagatgtttcagat
aatcatgcaaagattggacttatagatggtagtaaagctaagatacctattgttgaaatg
caatgggcaagaagcaatcttaaatcagtgaagaccttgcttaaaaaaggtgatgtgata
gtggttgagcctataaaagattgctatgctttgcgtcagatccctgaggttaacggagct
attatggttatgaatccgcataccggccaggtacttgcaagtgttggcggttatgatttt
tctacaagtaaatttgatagggtaactcaagcacttcgtcaaccaggttctttgagtaaa
acatttgtgtatctcgcagctcttgaaaacggcgttaagcctaatcagatttttaacgat
ggacctattgagattattcaaggtccagggatgcctagttggtgtcctaaaaattatgaa
ggtcagtttttaggtgacatgactatgcgtaccggttttgaaaaatcccgtaatcttata
acagtaagagtagcaactgctgtagggcttacaaaaatagttgatataattaagcgattt
ggtattaataatgaaccaaaaaaagtttattctatggtacttggttcaattgaaaccaca
cttagcagaataactaatgcttatgcaattattgctaatggtggtaaaaaagttgagcct
cattttgttgaattaattcaagaccgtaacggtaaaattatttatagacgagataataga
gaatgtttttcttgtaatattgcggatagtgatttagatactgcaatattagaaataccg
aaagaagatatatatagagttaccgatgaagctagtaattatcaaattacttcattttta
acaggagcaatagatagtggtactggttatgctgcgaggaagcttggcaaaattattgct
gggaaaactggtactagtaacgatagtaaggatacatggtttataggctttacgcctaag
atagtagtcgggagttatgttgggtacgatacaccgaaagaacttggaaaaaaagcaaca
ggctcaaacgtagtattgccgatttttattgattttatgaatcacgcttataaggacgaa
ccgtcgctaccttttaaagttccggactcaattaagctaatcgctgtagatagaataaca
ggtaaaatgatacccaacggcactgttatagaagcatttaaagtaaataatattcagatg
cttgagaatgattatatgattgataatcatgatatttttgattatgtgcctggtatgtta
gatcaatcgcaggaaatttactag

DBGET integrated database retrieval system