KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0111Help
Entry
Rpal_0111         CDS       T00722                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
rpt  Rhodopseudomonas palustris TIE-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 Pyr_redox_3 NAD_binding_7 AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACE98673
UniProt: B3Q644
LinkDB All DBs
Position
complement(122594..123634)
Genome map
AA seq 346 aa AA seqDB search
MKAAVFEKTGERLVVRDVAAPALGDNELLLKVAFTGICGSDLHAAETPGMLQSGTVMGHE
FTGEIVQSTAPDWPVGARVAANPYWLCDACAAGGSCSGGGDAACANGSFMGFRPDLPGAY
ADYVRIRAGQAIRLPDKVSLRDGALMEPLAVARHAVDVCGPMQGADVLVIGGGPIGLGVV
LMARDAGAARVVVSEPDPNRRACALQVGAVAAIDPIAEDLPTALGGLGLGAPGIVFECVG
APGFLQQTIDVMALRGRAVIVGVCMTEDRVLPRAAIRKEATLKFVLGYTMADFHHVSRYL
EEHAATAAAMISRVVSLSELPEIFDRLRAEKSLIKVLVRPDQGSGT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagtgttcgagaaaaccggggagcggctcgtcgtccgcgacgtcgccgcg
ccggcgctgggcgataacgaattgctgctcaaggtggcgttcaccggcatctgcggctct
gatctgcacgccgccgagacgccgggcatgttgcagtccggcactgtgatggggcacgaa
ttcaccggcgaaatcgtgcagtcgaccgcgcccgactggccggtcggcgcccgcgtcgcg
gccaacccgtattggctatgcgacgcctgcgcggccggcggctcttgtagcggcggcggc
gatgcggcctgtgccaacggcagcttcatgggcttccgtcccgacctgccgggggcctat
gcggactacgtgcggattcgcgccgggcaggcgatccgcctgcccgataaagtcagcctg
cgcgacggcgcgctgatggagccgctggccgttgcgcgtcatgcggtggatgtctgcggc
ccgatgcagggcgccgacgtgctggtgatcggtggcgggccaatcgggctcggcgtcgtg
ctgatggcgcgcgatgccggcgccgcgcgggtggtggtcagcgagccggatccgaaccgc
cgtgcctgcgcgctgcaggtcggtgccgtcgcggcgatcgatccgatcgccgaagatctg
ccgaccgcgctcggcgggctcggcctcggtgcgccgggcatcgtgttcgaatgcgtcggc
gcgcccggctttttgcagcagaccatcgacgtcatggcgctgcgcggccgggccgtgatc
gtcggcgtctgcatgacggaggaccgggtgttgccgcgcgccgcgatccgcaaggaagcg
acgctcaaattcgtgctcggctacacgatggccgacttccatcacgtcagtcgttatctc
gaggagcatgctgcgaccgccgccgcgatgatctcgcgcgttgtgtcgctgagtgagctt
cccgagatcttcgaccggctgcgcgccgagaagtcactgatcaaggtgctggtgcggccg
gaccagggatctggcacataa

DBGET integrated database retrieval system