KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0717
Entry
Rpal_0717         CDS       T00722                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00362  Benzoate degradation
rpt01100  Metabolic pathways
rpt01120  Microbial metabolism in diverse environments
rpt01220  Degradation of aromatic compounds
Module
rpt_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpal_0717
Enzymes [BR:rpt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     Rpal_0717
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ACE99276
UniProt: B3QDG3
LinkDB
Position
complement(751984..752760)
AA seq 258 aa
MSSNPILTETQGRVGIITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRA
FAAGADIASMAAWSYSDVYGSNFITRNWETIRQVRKPVLAAVAGLAYGGGCELALACDIV
IAGRSAKFALPEIKLGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRV
VDDDRLRDETVALATTIAAFSAPALMVLKESLNRAFESTLAEGILFERRELHARFASADA
REGIQAFLEKRAPRFSHR
NT seq 777 nt   +upstreamnt  +downstreamnt
ttgtcgtccaatcctatcctcaccgaaacccagggccgggtcggcatcatcacgctgaac
cggccggatgtgctcaacgcgctcaacgatgccctgatggatgcgctcggcggcgcgctg
ctggcgttcgacgccgacgacggcatcggcgcgatcgtgatcgccggcaatacccgggcc
ttcgcggccggcgccgacatcgcctcgatggcagcatggagctatagcgacgtctatggc
tcgaacttcatcacccgcaactgggaaacgatccgccaagtgcggaagccagtgctggcc
gcggttgccggcctcgcctatggcggcggctgcgagctggcactggcctgcgatatcgtg
atcgctggccgcagtgccaagttcgcgctgcccgaaatcaagctcggcctgctgcccggc
gccggtggcacgcaacggctgccgcgcgcgatcggtaaagccaaggcgatggacatgtgc
ctgtcggcgcggccgctcaacgccgaagaggccgatcgctatggtctggtctcccgcgtc
gtcgatgacgacaggctgcgtgacgagaccgtcgcgctggccaccacgatcgcggcgttc
tccgctccggcgctgatggtgctgaaggaaagcctcaatcgcgcattcgagagcacgctc
gccgaaggcatcctgttcgagcgccgtgaactgcacgcccgcttcgccagcgccgacgct
cgcgaggggattcaggccttcctggagaagcgcgcaccgcgcttctcccaccgctag

DBGET integrated database retrieval system