KEGG   Rhodopseudomonas palustris TIE-1: Rpal_0888Help
Entry
Rpal_0888         CDS       T00722                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpal_0888
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpt02000]
    Rpal_0888
Enzymes [BR:rpt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rpal_0888
Transporters [BR:rpt02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rpal_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N_2 GST_N GST_N_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ACE99445
UniProt: B3QEG6
LinkDB All DBs
Position
complement(949277..949891)
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALSEAGLPFDLVKVDIRAKKLENGDDYAAINPKGSVPALGLDDG
SVLTEGPAIVQFIADKEGSGKLAPANGSPERYRLQEWLNYISTDLHKSFGPLFAPTLGDD
AKNFFKDRIARHLGYVDKQLAGKDYLMGSSFTVADGYLFVILSWCDRMKIDLAPYPNLAA
FKARVAARPKVQEAMQSEGLLQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattattcacccggtgcatgttcgctgtcgccgcatatcgcgctcagcgag
gccggcctgccgttcgacctggtcaaggtcgacatccgggcgaagaagctggagaacggc
gacgactacgccgcgatcaatccgaaggggtcggtgcctgcgctcggcctcgacgacggc
tcggtgctgaccgagggaccggcgatcgtgcagttcatcgccgacaaggaaggctccggc
aagctggcgccggccaacggatcgccggagcgctaccggctgcaggaatggctgaactat
atctcgaccgacctgcacaagagcttcggcccgctgttcgccccgacgctcggcgacgat
gccaagaatttcttcaaggaccgcatcgctcgccacctcggctatgtcgacaagcagctc
gccggcaaagactatctgatgggctcgtcgttcacggtggccgacggctatctgttcgtg
atcctgagctggtgcgaccggatgaagatcgacctcgccccctaccccaacctcgccgcc
ttcaaggcccgcgtcgccgctcggccgaaggtgcaggaagcgatgcaaagcgaagggctg
ctgcagaaggcgtaa

DBGET integrated database retrieval system