KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1733Help
Entry
Rpal_1733         CDS       T00722                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00860  Porphyrin and chlorophyll metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpal_1733
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Rpal_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_26 MipZ AAA_24 SRP54 AAA_25 NB-ARC CBP_BcsQ
Motif
Other DBs
NCBI-ProteinID: ACF00261
UniProt: B3Q7C7
LinkDB All DBs
Position
1860125..1861063
Genome map
AA seq 312 aa AA seqDB search
MNILTDPNKLKTSGCADVNASKCAEGDGEGSVQVQLDPNLNIGTAKVFSIYGKGGIGKST
TSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKKLMPTVIDVLESVNFHSEEVRPEDFVF
EGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFASP
LQHSERAMIVAANDFDSIFAANRIAAAIQAKSKNYAVRLAGVIANRSRETDQIDKFGERT
GIKRVAHLPDLDVIRKSRLKKMTLFEMDHTPEIEAVQNEYLRLATELWEAKEPPVQGKPL
KDRDIFDLLGFD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctgactgatcccaataagctcaagacctcgggctgcgccgacgtcaacgcg
tcgaaatgcgccgagggcgacggcgagggcagtgtccaggtccagctcgaccccaacctc
aacatcggcaccgccaaggtgttctcgatctacggcaagggcggcatcggcaagagcacg
acctcgtcgaacctgtcggtggcgttctccaagctgggcaagcgcgtgctgcagatcggc
tgcgatccgaagcacgactccaccttcacgctcaccaagaagctgatgccgacggtgatc
gacgtcttggagtcggtgaacttccactccgaggaggtacgccccgaagacttcgtgttc
gagggctacaacggcgtgatgtgcgtcgaggcgggcggcccgccggccggcaccggctgc
ggcggctacgtcgtcggccagaccgtcaagcttctcaaggagcatcacctgctcgaagat
accgacgtggtgatcttcgacgtgctcggtgacgtggtgtgcggcggcttcgcttcgccg
ctgcagcattcggagcgggcgatgatcgtcgccgccaacgatttcgattcgatcttcgcc
gccaaccgcatcgccgcggcgatccaggcgaagtcgaagaattatgccgtccgtctggcg
ggagtgattgccaatcgcagtcgcgagaccgaccagatcgacaagttcggcgagcgcacc
ggcatcaagcgcgtcgcgcatctgccggatctggatgtcatccgaaagagccgtctgaaa
aagatgacgctttttgagatggatcacaccccagaaattgaagctgtgcaaaatgagtat
cttcggctcgcgacggaattgtgggaggcgaaggaacccccggtccagggcaagccgctg
aaggatcgcgacatctttgatctcttgggatttgattga

DBGET integrated database retrieval system