KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1748Help
Entry
Rpal_1748         CDS       T00722                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00630  Glyoxylate and dicarboxylate metabolism
rpt00710  Carbon fixation in photosynthetic organisms
rpt01100  Metabolic pathways
rpt01120  Microbial metabolism in diverse environments
rpt01200  Carbon metabolism
Module
rpt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rpt_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rpal_1748
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rpal_1748
Enzymes [BR:rpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rpal_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772
Motif
Other DBs
NCBI-ProteinID: ACF00276
UniProt: B3Q7E2
LinkDB All DBs
Position
1876697..1877119
Genome map
AA seq 140 aa AA seqDB search
MRLTQGCFSFLPDLTDEQIAAQVQYALSKGWAVNLEFTDDPHPRNTYWDMWGLPMFDLQD
AAGVMMELNECRKIYGDRYIRLSAFDSSHGWESVRLSFIVNRPKDEPGFRLDRQESDGRN
MRYTTRAYSADKPEGRRYGG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgacccaaggctgtttctcgttcctgccggatctcaccgacgaacagatcgcc
gctcaggtgcaatacgcgctgtccaagggctgggcggtgaacctcgaattcaccgacgat
ccgcatccccgcaacacctattgggacatgtggggcctgccgatgttcgatctgcaggac
gccgccggcgtgatgatggaactgaacgaatgccgcaagatctacggcgaccgctacatc
cggctgtcggcgttcgactcctcgcacggttgggagtcggtgcggctgtcgttcatcgtc
aaccgcccgaaggacgagcccggcttccggctcgaccgtcaggagtccgacggccgcaac
atgcggtacaccacacgcgcctattcggccgacaagcctgaaggccgccgctacggaggc
tga

DBGET integrated database retrieval system