KEGG   Rhodopseudomonas palustris TIE-1: Rpal_1972Help
Entry
Rpal_1972         CDS       T00722                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00620  Pyruvate metabolism
rpt00680  Methane metabolism
rpt00710  Carbon fixation in photosynthetic organisms
rpt01100  Metabolic pathways
rpt01120  Microbial metabolism in diverse environments
rpt01200  Carbon metabolism
Module
rpt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpal_1972
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rpal_1972
   00680 Methane metabolism
    Rpal_1972
Enzymes [BR:rpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rpal_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACF00495
UniProt: B3Q9M3
LinkDB All DBs
Position
2131054..2133864
Genome map
AA seq 936 aa AA seqDB search
MSSLNLSAGPEPVSERPDDAAAIEAETRLRNDIRLLGRILGDTVREQEGQSVFDLVENIR
QTSIRFHRDDDKTARAELAAILDGMSIQDTMRIVRAFSYFSHLANIAEDQNNIRQMRAGS
TAGSAPRAGLLAKTLAHARQEGISAAELRKFFATALVSPVLTAHPTEVRRKSTMDREMQI
AGLLDQRDRVQLTADEWADNEEWLRRAVETLWKTNLLRRTKLTVLDEVTNGLSFYDYTFL
REVPRLHSALEDRLADAAKAEGANAEGELASFLRMGSWIGGDRDGNPFVTAEVLHGTLKL
QSTRVLRYYLEELHELGSELSLASHLAGTTDTVKALAETSPDTSPHRKYEPYRLAVSGIY
ARLAATALKLEVENLRTPVGEAEPYASAQDFKTDLDAIHLSLTTHHSGVIARGRLRQLRR
AIDCFGFHLASLDMRQNSAVHERTVGELMDAARPGTSYAVLDEEARIALLISELRSTRPL
TSMFVKYSDETVGELAVFREAAKAHATYGAAAIPQCIISMTKGVSDLLEVAVLLKEVGLI
DPSGRSAINVVPLFETIEDLQACAKIMDRLLSIPEYRRLVDSRGSVQEVMLGYSDSNKDG
GFVTSGWELYKAEIGLIEIFEHHGVRLRLFHGRGGSVGRGGGPSYDAIVAQPGGAVNGQI
RITEQGEIITSKYSNVEVGRNNLEILAAATLEASLLQPKRVAPHRDYLEAMEQLSALAFK
AYRGLVYETDGFVDYFWASTVINEISTLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRL
MLPGWYGFGSAVSAWVTEHPDKGIAFLQAMYQEWPFFRTLLSNMDMVLSKSSIGIASRYA
ELVEDTAIRDRIFGRIRAEWHSSIDYLLAIMQQDHLLQSNPLLERSIRHRFPYLDPLNHV
QVQLLREHRTHDPDEQVLRGVQLTINGISAGLRNSG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgctgaatctgtccgccggccccgagccggtctccgaacgtcctgacgacgct
gccgcgatcgaggccgagacccggctgcgcaacgacatccggctgctcggccgcattctc
ggcgataccgtgcgcgagcaggaaggccagagcgtgttcgatctggtcgagaacatccgc
cagacctcgatccgcttccatcgcgatgacgacaagaccgcgcgcgccgagctcgccgcc
attctcgacggcatgtcgatccaggacacgatgcggatcgttcgcgccttcagctatttc
tcgcacctcgccaacatcgccgaggaccagaacaacatccgccagatgcgcgccggctcg
accgccggctcggcgccgcgcgccggcctgctcgccaagactctggcgcacgcgcggcag
gagggcatcagcgccgcggagctgcgcaagttctttgcgaccgcgctggtcagtccggtg
ctgaccgcgcatccgaccgaggtgcgccgcaagagcacgatggaccgcgagatgcagatc
gcaggattgctcgatcagcgcgaccgcgttcagctcaccgccgacgaatgggccgacaac
gaggagtggctgcgccgcgccgtcgagacgctgtggaagaccaacctgctgcgccggacc
aagctgacggtgctggacgaagtcaccaatgggctgtcgttctacgactacaccttcctg
cgcgaggtgccacggctgcacagcgcgctggaggaccggctcgccgatgcggcgaaagcc
gaaggcgccaacgccgagggcgaactcgccagcttcctgcggatgggaagctggatcggc
ggcgaccgcgatggcaatccgttcgtcaccgccgaggtgctgcacggcaccttgaagctg
cagagcacgcgggtgctgcgctattatctcgaggagctgcacgagctcggctcggaattg
tcactggcctcgcatctcgccggcaccaccgacaccgtcaaggcgctggccgaaacttcg
cccgacacttcgccgcatcgcaaatacgagccgtatcggctcgcggtgtccggcatctat
gcgcggctggctgccacggcgctcaagctcgaggtcgagaacctccgcacaccggtcggc
gaggccgagccctatgccagcgcgcaagacttcaagaccgatcttgacgccatccatctt
tccctgaccacgcatcattccggcgtgatcgcacgcggtcggctgcgccagctccgtcgt
gcaatcgactgtttcggattccacctcgccagcctcgacatgcggcagaactcggcggtg
catgagcgcaccgtcggcgagctgatggacgcggcccggccgggtacgtcctacgcggtg
ctcgacgaggaagcgcggatcgcgctgctgatcagcgagttgcgcagtacccggccgctg
acctcgatgttcgtcaaatacagcgacgagacggtcggcgagcttgcggtgttccgcgaa
gcggcgaaggcccatgcgacctacggggcggcggcgatcccccaatgcatcatttcgatg
accaagggcgtctcggatctcttggaggtcgcggtgctgctcaaggaagtcgggttgatc
gatccgtccgggcgcagcgccatcaacgtcgtgccgctgttcgagaccatcgaggatctg
caggcctgcgccaagatcatggaccggctgctgtcgatccccgaatatcgccgcctggtc
gacagccgcggctcggtgcaggaggtgatgctcggctactccgacagcaataaggacggc
ggcttcgtcacctcaggctgggagctgtacaaggccgagatcggtctgatcgagatcttc
gagcaccacggcgttcggctgcggctgttccacggccgtggcggctcggtcggccgcggc
ggcggcccgagctacgatgcgatcgtggcgcagccgggtggtgcggtgaacggccagatc
cgcatcaccgagcagggcgagatcatcaccagtaaatattccaacgtcgaagtcggccgc
aacaatctcgagatcctcgccgccgcgacgctggaagcgagcctgctgcagccgaagcgc
gtggcgccgcaccgcgattatctcgaagcgatggagcagctctcggcattggccttcaag
gcgtatcgcggcctggtgtacgagaccgacggcttcgtcgattacttctgggcctcgacg
gtgatcaatgagatttcgacgctgaacatcggcagccgcccggcctcgcgcaagaagacc
cgcgcgatcgaggacctgcgcgcgatcccatgggtgttctcgtgggcgcagtgccggctg
atgctgccgggctggtatggcttcggcagcgcggtgtcggcctgggtcactgagcacccc
gacaagggcatcgcctttctgcaggcgatgtatcaggagtggccgttcttccgtacgctc
ttgtcgaatatggacatggtgctgtcgaagagctcgatcggcatcgcctcgcgctatgcg
gagctggtcgaagacaccgcgatccgcgaccgcatcttcggccgcatccgcgccgaatgg
cattcgtcgatcgactatctcctggcgatcatgcagcaggaccatttgctgcagagcaac
ccattgctcgaacgctcgatccgccaccgcttcccgtatctcgatccgctgaaccacgtc
caggtccagctgctgcgcgaacatcgtacccatgatccggacgagcaggtgctgcgcggc
gtgcaactgacgatcaacgggatttccgcggggctgcggaatagcgggtga

DBGET integrated database retrieval system