KEGG   Rhodopseudomonas palustris TIE-1: Rpal_2567Help
Entry
Rpal_2567         CDS       T00722                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00250  Alanine, aspartate and glutamate metabolism
rpt00280  Valine, leucine and isoleucine degradation
rpt00410  beta-Alanine metabolism
rpt00640  Propanoate metabolism
rpt00650  Butanoate metabolism
rpt01100  Metabolic pathways
rpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rpal_2567
   00650 Butanoate metabolism
    Rpal_2567
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rpal_2567
   00280 Valine, leucine and isoleucine degradation
    Rpal_2567
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rpal_2567
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpt01007]
    Rpal_2567
Enzymes [BR:rpt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rpal_2567
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Rpal_2567
Amino acid related enzymes [BR:rpt01007]
 Aminotransferase (transaminase)
  Class III
   Rpal_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACF01080
UniProt: B3QFK7
LinkDB All DBs
Position
2772643..2773917
Genome map
AA seq 424 aa AA seqDB search
MTNSELLTRRQTAVVRGVSQATPVFAERALNSEIWDVEGKRYVDFAGGIAVLNTGHCHPR
IVAAIREQLDRFTHTCFQVAPYEGYIRLAERLNQLAPINGPLKSILLSTGAEATENAVKI
ARAATGRSGVIAFTGGFHGRTAFASAMTGKVIPYKKALGPPLPGVWHVPFPVAGSDVSVE
DALRCVQFVFKADIDASQVAAIIIEPVQGEGGFHQAPPELMRGLRRLCDENGIVLIADEV
QTGFGRTGKMFAMEHYDVQADIVCVAKSLAGGLPLSGVIGRAAIMDAAEPGGLGGTYAGN
PLACAAALAVLDVFEEENLIARANQIGERLRSAIDRFALSNTLVPTSVARGPGAMVAFDI
LKQRGSNEPDAEATRRVTRLAHENGLILLSCGTAANTIRILVPLTASDAIVDEGLAILER
CLAA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatagtgaattgctgacgcgcaggcagacggctgtcgtgcggggcgtcagccaa
gcgacgccggtgtttgcagaacgtgcgctgaacagcgagatctgggacgtcgagggcaag
cgttacgtcgatttcgccggcggcattgccgtgctcaacaccggtcattgccatccgcgc
atcgtcgcggcgatccgtgagcagctcgatcgcttcactcacacctgtttccaggtcgcg
ccttatgaaggttacatccggctcgccgagcgcctgaatcagttagcgccgatcaacggg
ccgctgaagtcgatcctgctgagcaccggtgcggaagccaccgagaacgccgtcaagatc
gcgcgcgccgcgaccggccgcagcggcgtgatcgccttcacgggtggtttccatggccgc
actgcattcgcctcggcgatgaccggcaaggtcattccttacaagaaggcactcggtccg
ccgcttcctggcgtctggcatgttccgttcccggtcgccggtagtgacgtctcggtcgag
gatgcgctgcgctgcgtgcagttcgtgttcaaggccgatatcgatgcgtcgcaggttgcc
gcgatcatcatcgagccggtgcagggcgagggcggcttccatcaggcgccgcccgaactg
atgcggggcttgcgcaggctgtgcgacgagaacggcatcgtgctgatcgccgacgaagtg
cagaccggcttcgggcgcaccggcaagatgttcgcgatggagcactacgacgttcaggcc
gacatcgtctgcgtcgccaagagccttgccggcggcttgccgctgtcgggcgtgatcggc
cgcgccgcgatcatggatgcggcggagccgggcggcctcggcggtacctatgcgggcaat
ccgctggcctgcgccgcagcgctcgcggtgctcgatgtgttcgaagaggagaatttgatc
gcgcgtgcgaaccagatcggcgagcggctgcgcagcgcgatcgatcggttcgcgctgtcg
aacacgctggtgccgacctcggtcgcgcgcggccctggtgcgatggttgcattcgacatc
ctcaagcagcgcggcagtaacgagccggatgcggaggcgaccaggcgggtgacccggctg
gcgcacgagaacggtctgatcctgctgtcgtgcggcaccgccgccaacaccattcgcatt
ctggtgccgctgacggcctccgatgcgatcgtcgacgaagggttggcgatcctggagcgc
tgcctcgccgcttag

DBGET integrated database retrieval system