KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3253Help
Entry
Rpal_3253         CDS       T00722                                 

Definition
(GenBank) citrate synthase I
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00020  Citrate cycle (TCA cycle)
rpt00630  Glyoxylate and dicarboxylate metabolism
rpt01100  Metabolic pathways
rpt01110  Biosynthesis of secondary metabolites
rpt01120  Microbial metabolism in diverse environments
rpt01130  Biosynthesis of antibiotics
rpt01200  Carbon metabolism
rpt01210  2-Oxocarboxylic acid metabolism
rpt01230  Biosynthesis of amino acids
Module
rpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
rpt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rpal_3253
   00630 Glyoxylate and dicarboxylate metabolism
    Rpal_3253
Enzymes [BR:rpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     Rpal_3253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: ACF01755
UniProt: B3Q6P6
LinkDB All DBs
Position
3498985..3500289
Genome map
AA seq 434 aa AA seqDB search
MDATTNNKTATLTVGNKNFDLPVLTGTVGPDVIDIGKLYAQTGMFTYDPGFTSTASCQSK
ITYIDGDAGVLEYRGYPIEQLAEKGDFLETCYLLLYGELPTKAQKEDFDYRVTRHNMVHE
QMARFFQGFRRDAHPMAVMVASVGALAAFYHDSTDINDPTQRMVASIRMIAKVPTLAAMA
YKYSVGQPFIYPKNTLSYAANFLRMCFATPCEEYVVNPVLANALDKIFTLHADHEQNAST
STVRIAGSSGANPFACIAAGIACLWGPAHGGANEAALAMLKEIGTVENIPDFIAKVKDKS
SSVRLMGFGHRVYKNYDPRAKIMQQVCHEVLAETGHHGDPLLKVAMELEKIALSDQYFID
RKLYPNVDFYSGITLKAMGFPTDMFTVLFAVARTVGWISQWSEMIEDPQQKIGRPRQLFT
GATTRNYVEIGKRG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaacgaccaacaacaaaacggcaacgctgacggttggaaacaagaacttcgat
cttccggtgctcaccgggacagtcggtcccgacgtcatcgacatcggcaagctctacgcg
cagaccggaatgttcacctacgatccgggcttcacgtcaacggcgagctgccagtccaaa
atcacttacatcgacggcgacgcaggcgttctcgagtatcgcggttacccgattgaacag
ctcgccgaaaaaggcgacttcctagaaacttgctatctcttgctgtacggcgaattgccg
accaaggcgcagaaggaagatttcgactaccgcgtcacccggcacaacatggttcacgag
cagatggcccggttcttccagggcttccgtcgtgacgcgcatccgatggcggtgatggtg
gcttcggtcggcgcgctcgccgcattctaccacgactccaccgacattaacgatccgacc
cagcggatggtcgcttcgatccggatgatcgcgaaggtcccgacgctggccgcgatggcc
tacaagtactcggtgggccagcccttcatctatccgaagaacacgctcagctacgcagcg
aacttcctgcggatgtgcttcgcgactccgtgcgaggagtacgtcgtcaatccggtgctg
gcgaacgcgctcgacaagatcttcacgctgcacgccgaccacgagcagaacgcctcgacc
tcgaccgtgcgcatcgccggctcgtcgggtgccaatccgttcgcctgtatcgcggccggt
atcgcctgcctgtggggcccggcgcatggcggtgcgaacgaagcggcgctggcgatgctg
aaggagatcggcaccgtcgagaacatcccggacttcatcgccaaggtgaaggacaagagc
tcgtcggtacggctgatgggcttcggccaccgcgtctataagaactacgatccgcgcgcc
aagatcatgcagcaggtctgccacgaagtgctggccgaaaccggccatcacggcgacccg
ctgctcaaggtggcgatggagctcgagaagatcgcgctcagcgatcagtacttcattgac
cgcaagttgtacccgaacgtcgacttctattcgggcatcacgctgaaggcgatgggcttc
ccgacagacatgttcaccgtgctgttcgcggtcgcccgcactgtcggctggatcagccag
tggagcgagatgatcgaggacccgcagcagaagatcggccgtccgcgccagctcttcacc
ggcgcgaccacccgcaactacgtcgagatcggcaagcgcggctga

DBGET integrated database retrieval system