KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3256Help
Entry
Rpal_3256         CDS       T00722                                 

Definition
(GenBank) protein of unknown function DUF1009
  KO
K09949  uncharacterized protein
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rpal_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxI_C LpxI_N
Motif
Other DBs
NCBI-ProteinID: ACF01758
UniProt: B3Q7J2
LinkDB All DBs
Position
complement(3502346..3503203)
Genome map
AA seq 285 aa AA seqDB search
MTDPSLQIGAPVGIIAGGGTLPFAVADSLAARGLTPVLFALKGSCDPERVTAYRHHWLRM
GAFGRLLRLLRDEGCRDLVFIGSLVRPALSDMRLDWGAIKVLPAVLAAYRGGDDHLLTGV
GRLFERHGFRLLGLKDVATDLLMPAGCLTRAVPDAGVEADIAKGRAVLAALSPFDIGQGC
VVIDGHVVAVEDTGGTDELLRRVAQLRDSRRIRAKPGHGVLVKAPKTGQDLRFDLPALGP
KTIEGLIAAQLGGVAVVAGHTVVAEPQEMIAAADKAGVFAIGMPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccatcactgcagattggcgcgcccgtcggcatcatcgccggcggcggaacg
ttgccgttcgcggttgccgactcgctcgcggcgcgcggcctgacaccggtgctgttcgcc
ctgaaggggagctgcgaccccgagcgtgtcaccgcgtatcggcatcactggctccggatg
ggagctttcggcaggctgctgcggctgctacgcgacgaggggtgccgcgacctggtgttc
atcggctcgttggtgcggccggcactgtcggacatgcggctcgactggggcgcgatcaag
gtgctgccggcggtgctcgcggcctatcggggcggtgacgatcacctcctgaccggcgtc
ggccggctgttcgagcgccacggcttccgcctgctcggcctgaaggatgtggccaccgat
ctgctgatgcccgcgggctgtctcactcgcgctgtgccggatgctggcgttgaagccgac
attgccaaagggcgcgcggtgctggcggcgctcagcccattcgacatcggccagggctgc
gtcgtgatcgatggtcacgtcgtggctgtcgaagacaccggcggcaccgacgagctgcta
cggcgcgtggcgcagcttcgcgacagccggcgaatccgggccaagccgggacatggcgtg
ctggtgaaggcgcccaagaccggtcaggacctgcgcttcgatctgcctgcgctcgggccg
aaaaccatcgaaggactgatcgccgcacagctcggcggtgttgccgtggtggccgggcat
accgtcgtggccgagccgcaggagatgatcgcggctgccgacaaggccggcgtgttcgcg
atcgggatgccggcatga

DBGET integrated database retrieval system