KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3514Help
Entry
Rpal_3514         CDS       T00722                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00970  Aminoacyl-tRNA biosynthesis
rpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rpal_3514
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpt03029]
    Rpal_3514
Enzymes [BR:rpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rpal_3514
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rpal_3514
Mitochondrial biogenesis [BR:rpt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rpal_3514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF5490
Motif
Other DBs
NCBI-ProteinID: ACF02015
UniProt: B3Q9W2
LinkDB All DBs
Position
complement(3761231..3762793)
Genome map
AA seq 520 aa AA seqDB search
MNAPVKPSKLIKGATGDWEVVIGLEIHAQVSSNAKLFSGAATAFGGDQNTHVSLVDAAMP
GMLPVINEECVRQAIRSGLGLNAKIHLRSVFDRKNYFYPDLPQGYQISQYKSPIVGEGEV
VVDLPDGDSITVGIERLHLEQDAGKLLHDQHPTSTFVDLNRSGVALMEIVSKPDLRSSEQ
AKAYVSKLRTIMRYLGTCDGDMEKGSLRADVNVSVRRPGEPYGTRCEIKNVNSIRFIGQA
IEYEAQRQIGILEDGGKIDQETRLFDANKGETRSMRSKEEAHDYRYFPDPDLLPLEFTQA
YVDELKSGLPELPDAKKARYLKEFSLSDQDADVLVAEPERAAYFEKMVANGAEPKAAANW
FINEYLGQISKVEESDSVPAVVEPTISVSVGHGSTSRSGQITINWTAPEANSAIVRMVTS
NLISGKSAKALLGLVIEIGPVADPDDVKTIVEHLNLKQVTDLSAIEKVVDDIVAANPDKV
AQVVAKPAMLGWFVGQVMKSSGGKANPQAVNDLLKRKLGL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacctgtcaaaccttcgaaactcatcaagggcgccaccggcgattgggaagtc
gtgatcgggctggagatccatgcccaggtctcttccaatgccaagctgttctccggcgcg
gctaccgcgttcggcggcgatcagaacacccacgtgtcgctggtcgacgccgcgatgccc
ggcatgctgccggtgatcaacgaggagtgcgtgcgccaggcgatccgctccgggctcggg
ctgaacgccaagatccatctgcgctcggtgttcgaccgtaagaactatttctacccggac
ctgccgcagggctaccagatcagccagtacaaatcgccgatcgtcggtgagggcgaagtg
gtggtcgacctgccggacggcgacagcatcaccgtcggcatcgagcggctgcatctcgaa
caggacgccggaaagctgctgcacgaccagcatccgacttcgacattcgtcgacctcaac
cgctccggcgtcgcgctgatggagatcgtctccaagccggacctccgctcgtccgaacag
gccaaggcttacgtgtcgaagctgcgcacgatcatgcgctatctcggcacctgcgatggc
gacatggagaagggcagcctgcgcgccgacgtcaacgtctcggtgcgccgtccgggcgag
ccttacggcacccgctgcgagatcaagaacgtcaactcgatccgcttcatcggtcaggcg
atcgaatacgaagcgcagcgccagatcggcattctggaagacggcggaaagatcgaccag
gagacccggctgttcgacgccaacaagggcgagacccggtcgatgcggtcgaaggaagag
gcgcacgactatcgctacttccccgatccggatctgctgccgctggaattcacccaggcc
tatgtcgacgagttgaagtccggcctgccggaattgcccgacgccaaaaaagcgcgctat
ctaaaggagttttcgctttccgaccaagatgcagacgtgttggtcgcggaaccggaacga
gctgcctatttcgagaagatggtagccaacggtgcggagcctaaagctgcggccaactgg
tttatcaatgaatacctcggccaaatcagcaaggtcgaggagagcgatagcgtgcctgcc
gtggtcgaaccgaccatctctgtttctgttggacacggttcaacctcaaggtccgggcag
attacgatcaattggactgctcctgaggcaaacagcgcaattgtgaggatggtcacttcc
aacctcatcagcggaaagtcagcgaaggcactgctcgggttggtgattgaaattgggccg
gtcgccgatcccgatgacgtcaaaacgattgtggagcacctaaatctaaaacaagtcacc
gatctgtcggcgatcgagaaggtggtcgacgatatcgtcgccgccaatccagataaggtg
gcacaagtcgtcgccaagcccgcgatgctcggctggttcgtcggccaggtgatgaaatct
tccggcggcaaggccaatccgcaggcggtcaacgatctgctgaagcgcaagctcggcctc
tga

DBGET integrated database retrieval system