KEGG   Rhodopseudomonas palustris TIE-1: Rpal_3669Help
Entry
Rpal_3669         CDS       T00722                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rpt  Rhodopseudomonas palustris TIE-1
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rpt03012]
    Rpal_3669
   03029 Mitochondrial biogenesis [BR:rpt03029]
    Rpal_3669
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpt04147]
    Rpal_3669
Translation factors [BR:rpt03012]
 Eukaryotic Type
  Elongation factors
   Rpal_3669
 Prokaryotic Type
   Rpal_3669
Mitochondrial biogenesis [BR:rpt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Rpal_3669
Exosome [BR:rpt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Rpal_3669
  Exosomal proteins of breast cancer cells
   Rpal_3669
  Exosomal proteins of colorectal cancer cells
   Rpal_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACF02169
UniProt: B3QBY2
LinkDB All DBs
Position
complement(3916902..3918092)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVEMEVRELLSKYDFPGDDIPIVKGSALAALE
NSDAKLGHDAILELMRQVDAYIPQPERPIDQPFLMPVEDVFSISGRGTVVTGRVERGILK
VGDEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVAAIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtacgaagccgcattgcaacatcgggacgatcggtcac
gtcgaccacggcaagacgtcgctgacggcggcgatcaccaaggttctggcggagacgggc
ggtgcgacgttcacggcctatgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgaccgcgcacgtcgagtacgagacgcagaaccgtcactacgcgcacgtc
gactgccccggccacgcggactacgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgcgatcctggtggtgtcggcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccggcgctggtggtgttcctgaacaagtgcgacatg
gtcgacgatccggaactgctcgagctggtcgagatggaagtgcgcgagcttctgtcgaag
tacgacttcccgggcgacgacattccgatcgtcaagggttcggcgctggcggcgctggag
aactcggacgccaagctcggtcacgacgcgatcctggagctgatgcgccaggtcgacgcc
tacatcccgcagccggagcgtccgatcgaccagccgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggccgtgtcgagcgcggcattctgaag
gtcggcgacgaaatcgagatcgtcggcatccgcgacacgcagaagaccacctgcaccggc
gtcgaaatgttccgcaagctgctcgatcagggccaggcgggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgtgaggacgtcgagcgtggccaggtgctgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggccgaagcctacattctgaccaaggaagagggcggc
cgccacaccccgttcttcaccaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgttgtgcacctgccggaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagaaaagctgcgcttcgccatccgc
gaaggcggccgcacggtgggcgccggcgtcgtcgccgcgatcatcgagtaa

DBGET integrated database retrieval system