KEGG   Rhodopseudomonas palustris TIE-1: Rpal_4895Help
Entry
Rpal_4895         CDS       T00722                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpt  Rhodopseudomonas palustris TIE-1
Pathway
rpt00564  Glycerophospholipid metabolism
rpt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rpal_4895
Enzymes [BR:rpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rpal_4895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 Pyr_redox FAD_binding_3 NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACF03384
UniProt: B3Q829
LinkDB All DBs
Position
complement(5262331..5263866)
Genome map
AA seq 511 aa AA seqDB search
MVYDLAIIGGGINGCGIARDAAGRGHSVFLCEMNDLASGTSSWSTKLIHGGLRYLEYFEF
RLVREALIERERLWQIAPHIIGPLRFVLPHHDGLRPAWRLRLGLFMYDYLGGRKLLPPTR
SVDLAHDEVGKPLIPGRYTKGFEYSDCFVDDARLVVLTARDAAERGAEIRTRTRAVQVSQ
QGGIWQVTLEDVGSGARSTIQARALVNAAGPWVEGVLRSGAGVDARYKVRLVQGSHIVTR
KLYDHDRAYIFQNADGRIVFAIPYQGDFTLIGTTDRDYHGDPSQVKATPEEIDYLCKAVS
GYFAKPVTPADVVWTFSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGGKITTY
RRLAEEALEKLSSYLKGGTAKQGWTAHQPLPGGDFPVDGGPALIGDLLREYPFLASAHAS
RLVHAYGTRARDVLGSAKSAADLGRDFGATLTEAEVRYLMSREWACSADDIVWRRSKLGL
RLTPAAVAALDEWVIVHRAAEKPQQQAGGRA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacgacctcgcgatcatcgggggcgggatcaacggctgcggcatcgcgcgcgat
gcagcgggccgcggacattccgtgttcctgtgcgagatgaacgacctcgccagcggcacc
tcgtcgtggtcgaccaagctgatccatggcggcctgcgctatctcgaatatttcgagttt
cgcttggtgcgcgaggcgctgatcgagcgcgagcggctgtggcagatcgcgccgcatatc
atcgggcctctgcgtttcgtgctgccgcatcacgacggcctgcgtccggcctggcggctg
cggctcggcttgttcatgtacgattatctcggcggccggaagctgctgccgccgacccgc
tcggtcgatctggcgcatgacgaagtcggcaagccgctgattcccggtcgctacaccaag
ggcttcgaatactccgattgctttgtcgatgacgcgcggctggtggtgctcaccgcacgc
gacgcggccgagcgcggcgccgaaatccgcacccggactcgcgcagtccaggtcagccag
cagggcggcatctggcaggtgacgctggaagatgttggtagcggcgcgcgcagcacgatc
caggcgcgggcattggtcaacgccgccggcccctgggtcgaaggcgtgctccgctccggc
gccggggtcgatgcccgctacaaagtgcggctggtgcagggctcgcacatcgtcacccgt
aagctctacgaccacgaccgcgcctacatcttccagaacgccgacggccgcatcgtgttc
gcgattccctatcagggcgacttcaccctgatcggcaccaccgaccgcgactatcacggc
gatccgtcgcaggtgaaggcgacgccggaagagattgattatctctgtaaggcggtgagc
ggctatttcgccaagcccgtgacaccggccgatgtggtgtggaccttctcgggcgtgcgg
ccgctgtatgacgacggcgccagcgaagccaaggcggcgacccgcgactacgtgttcgag
ctcgacaccccgggcggcgcgccgctgctgtcgatctatggtggcaagatcaccacctat
cgccggctcgccgaagaggcgctggagaagctgtcctcctacctgaagggcggaacggcc
aagcagggctggaccgcgcatcagccgctgccgggcggcgatttcccggtcgacggcggt
ccggcgctgatcggcgacctgctgcgcgagtatccgttcctggcctccgcgcatgcctcg
cgcctggtgcacgcctacggcacccgggcgcgtgacgtgctcggctcggccaagtcggcg
gccgatctcggccgcgacttcggcgccacattgacggaggccgaggtccgctatctgatg
agccgcgaatgggcctgcagcgcggacgacatcgtctggcggcgatccaagctcggtttg
cggctgacgccggccgcggtcgccgcgctcgacgaatgggtcatcgtccaccgcgccgcc
gagaagccccagcagcaagcgggaggccgggcatga

DBGET integrated database retrieval system