KEGG   Ralstonia pseudosolanacearum: CDC45_00280Help
Entry
CDC45_00280       CDS       T05645                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rpu  Ralstonia pseudosolanacearum
Pathway
rpu00970  Aminoacyl-tRNA biosynthesis
rpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CDC45_00280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rpu03029]
    CDC45_00280
Enzymes [BR:rpu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CDC45_00280
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CDC45_00280
Mitochondrial biogenesis [BR:rpu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CDC45_00280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AST25769
UniProt: A0A223GI72
LinkDB All DBs
Position
complement(59066..60532)
Genome map
AA seq 488 aa AA seqDB search
MQWEVVIGLETHAQLSTASKIFSGASTAFGAAPNTQAAPVDLALPGVLPVLNKGAVERAI
TFGLAIGAKIASKSIFARKNYFYPDLPKGYQISQYEIPVVQGGTLTIQVEGRNGQPGYEK
TVNLTRAHLEEDAGKSLHEDFAGMTGIDLNRAGTPLLEIVTEPDMRSAAEAVAYARALHA
LVMWLGICDGNMQEGSFRCDANVSVRRGPDAPFGTRCEIKNLNSFRFLEEAINYEVRRQI
ELIEDGGTVVQETRLYDPDRKETRSMRSKEDAHDYRYFPDPDLLPLMIGADWVDAVRATL
PELPAAMAARFESAYGLPRYDASILTATKATAAYFEAVVAAAGAANAKAAANWIMGEVAS
NLNRAGLEIDAAPVSPVQLAGLLARIADGTISNNTAKKDVFPAMWAGEHGGDADAIIAEK
GLKQMSDSGELEKIIDEVLAANAKSVEEFRAGKDKAFNALVGQAMKATRGKANPSQVNEL
LKKKLGAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaagtggtgatcggcctcgaaacgcacgcacagctttcgaccgcctcgaag
attttctccggcgcctccaccgccttcggcgcggcgcccaacacgcaggccgcgccggtt
gatctggcgctgcccggcgtgctgccggtgctcaacaagggcgccgtcgagcgcgccatc
acgttcggcctggccatcggggccaagatcgcgtccaagagcatcttcgcgcgcaagaat
tacttctaccccgatctgcccaagggctaccagatcagccagtatgagattccggtggtg
cagggcggcacgctgaccatccaggtggaaggcaggaacgggcagcccggctacgagaag
accgtcaacctgacgcgcgcccacctggaagaagacgccggcaaatcgctgcacgaagac
ttcgccggcatgaccggcatcgacctgaaccgcgccggcacgccgctgctggagatcgtc
accgagcccgacatgcgcagcgcggccgaagccgtggcgtatgcccgcgcgctgcacgcg
ctggtgatgtggctgggcatctgcgacggcaacatgcaggaaggcagcttccgctgcgat
gccaacgtctcggtgcgccggggcccggacgcgccgttcggcacacgctgcgagatcaag
aacctgaactcgttccgcttcctggaagaggccatcaactacgaagtgcgccgccagatc
gagctgatcgaggacggcggcaccgtggtgcaggaaacccgcctgtacgaccccgaccgc
aaggaaacgcgctcgatgcgcagcaaggaagacgcgcacgactaccgctacttccccgac
cccgacctgctgccgctgatgatcggcgccgactgggtggacgcggtgcgcgccacgctg
ccggagctgcccgccgccatggccgcgcgcttcgaatcggcctacggcctgccccggtac
gacgccagcatcctgaccgccaccaaagccaccgccgcctacttcgaggccgtggtggcc
gccgccggcgcggccaacgccaaggcggccgccaactggatcatgggcgaggtggcctcg
aacctgaaccgcgccgggctggagatcgatgccgcgccggtgtcgcccgtgcaactggcc
gggctgctggcgcgcatcgccgacggcaccatctccaacaacaccgccaagaaggacgtc
ttccccgccatgtgggccggcgagcacggcggtgacgccgacgccatcatcgccgagaag
ggcctcaagcagatgtcggattccggcgagctggagaagatcatcgacgaggtgctggca
gccaacgccaagtcggtcgaggaattccgcgccggcaaggacaaggctttcaacgcgctg
gtgggccaggcgatgaaggccacgcgcggcaaggccaacccgagccaggtcaacgaactg
ctgaagaagaaactgggcgcagcctga

DBGET integrated database retrieval system