KEGG   Ralstonia pseudosolanacearum: CDC45_00320Help
Entry
CDC45_00320       CDS       T05645                                 

Gene name
mrdA
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
rpu  Ralstonia pseudosolanacearum
Pathway
rpu00550  Peptidoglycan biosynthesis
rpu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDC45_00320 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CDC45_00320 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpu01011]
    CDC45_00320 (mrdA)
Enzymes [BR:rpu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CDC45_00320 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:rpu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CDC45_00320 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer MucB_RseB
Motif
Other DBs
NCBI-ProteinID: AST25776
UniProt: A0A223GIA9
LinkDB All DBs
Position
67279..69684
Genome map
AA seq 801 aa AA seqDB search
MTEIRNVEQELSRFRVRLAAAALFVLVCFGLLLVRFFWLQSVKHEQYSAKAEDNRISVAP
IEPNRGIIMDRNGVVLARNYSAYTLEVTPSKLQDTLDNTIDQLAQVIDIQPRDRRRFKRL
MEDARSFESLPIRSQLTDQEVARFSAQRFRFPGVDVHARLFRQYPLGEAAAHVIGYIGRI
SERDLERIDDMSEANSQPNVTYDPRKDANNYSGTEYIGKVGIEQSYETELHGLTGYEEVE
VSAGGRPIRTLSTSQATPGNNLILSLDINLQRLAEQLFGNRRGALVAIEPETGDILAFVS
KPTFDPNLFIEGIDSATWSELNGSPDKPLLNRPLRGTYPPGSTYKPFMALAALELGKRTP
QWGMADPGSFTLGNHTFRDDVPGGHGWVDMYRSIVVSCDTYYYKLANDMGVNAIHDFMKP
LGFGQVTGIDIEGERTGILPSTEWKRKAYKRPEQQKWYDGETISLGIGQGYNNFTILQLA
HAVATLANNGGVMKPHLVKAVEDSVNKARTLTVPTESYRIPLKQANIDVIKRAMAGVVQA
GTAAKAFAGAQYAAAGKTGTAQVFSLGKGEKYNHHAIPEYKRDHALFEAFAPTDHPKIAV
ALIVENAGFGATSAAPIARAVFDYYLQGKWPAELAAIAPKVQPQPPVDTPSVFSTGKTAT
IASATATPQAAAEAVAQSAALAAAASGEQAADAATVGGASAPGASAVAAGAPRAAPAMSS
DRVAPALREAGTSAQAVAPATLDAQVLQALSHVQPAPDLPSPRGRNLPAAPASAPAASPK
DRKPAVKPNPKPAPKPARAAP
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatccgcaacgtcgaacaggagctgtcgcgctttcgcgtgcggctggccgcg
gccgcgctgttcgtgctggtgtgcttcgggctgctgctggtgcgcttcttctggctgcag
tcggtcaagcacgagcagtactcggccaaggccgaggacaaccgcatctcggtggcgccg
atcgagcccaaccgcggcatcatcatggaccgcaacggggtggtgctggcgcgcaactac
tcggcctacacgctggaggtcaccccgtccaagctgcaggacacgctggacaacaccatc
gaccagctcgcccaggtgatcgacatccagccgcgcgaccgtcgccgcttcaagcgcctg
atggaagacgcgcgcagcttcgagagcctgccgatccgcagccagctgaccgaccaggag
gtggcgcgcttctcggcacagcgcttccgcttcccgggcgtggacgtgcacgctaggctg
ttccgccagtacccgttgggcgaggcggcggcgcacgtgatcggctacatcggccgcatc
tccgagcgcgacctcgagcgcatcgacgacatgagcgaggccaacagccagcccaacgtc
acctacgatccgcgcaaggacgccaacaactacagcggcaccgagtacatcggcaaggtc
ggcatcgagcagagctacgagaccgagctgcacggcctgaccggctacgaagaagtcgag
gtcagcgcgggcgggcggccgatccgcacgctgtccacctcgcaggccacgcccggcaac
aacctgatcctgtcgctcgacatcaacctgcagcggctggccgagcagctgttcggcaac
cgccgcggcgcgctggtggcgatcgagcccgagaccggcgacatcctcgccttcgtctcc
aagcccaccttcgacccgaacctcttcatcgaaggtatcgacagcgccacctggagcgag
ctgaacggctcgcccgacaagccgctgctgaaccgcccgctgcgcggcacgtatccgccg
ggctcgacctacaagccgttcatggcgctggccgcgctggagctgggcaagcgcacgccg
caatggggcatggccgatcccggctcgttcacgctgggcaaccacaccttccgcgacgac
gtgccgggcggccacggctgggtcgacatgtaccgctccatcgtggtgtcgtgcgacacg
tactactacaagctcgccaacgacatgggcgtcaacgccatccacgatttcatgaagccg
ctcggcttcggccaggtcaccggcatcgacatcgagggcgagcgcaccggcatcctgccc
tccaccgagtggaagcgcaaagcctacaagcgtcccgagcagcagaagtggtacgacggc
gaaaccatctcgctgggcatcggccagggctacaacaacttcaccatcctccagctggcg
catgcggtggcgacgctggccaacaacggcggcgtgatgaagccccacctggtcaaggcc
gtcgaggattccgtcaacaaggcccgcacgctgacggtgccgaccgagagctaccggatt
ccgctcaagcaggccaacatcgacgtgatcaagcgcgcgatggccggggtggtccaggcc
ggcacggcggccaaggcgtttgccggcgcgcaatatgccgcggcgggcaagaccggcacg
gcgcaggtgttctcgctcggcaagggcgagaagtacaaccaccatgccattcccgaatac
aagcgcgaccacgcgctgttcgaggccttcgcgccgaccgaccacccgaagatcgcggtg
gcgctgatcgtcgagaacgcgggcttcggcgccacctcggccgcgccgatcgcgcgcgcg
gtgttcgactactacctgcagggcaagtggccggccgagctggcggccatcgcgcccaag
gtccagccgcagccgccggtcgatacgccgagcgtgttctccaccggcaagaccgccacc
atcgccagcgccacggccacgccgcaggcagccgcggaggcggtggcgcagagcgcggcc
ctggccgcggccgcatccggcgagcaggctgccgatgcagccacggtgggcggcgcgtcc
gcgccgggcgcttcggccgtggcggccggcgcaccgcgcgccgcgccggcgatgtcgtcc
gatcgggtcgcgcccgcgctgcgcgaggccggcaccagcgcccaggcggtcgctccggcc
acgctggacgcccaggtgctgcaggcgctgtcgcacgtccagcccgcccccgacctgccg
agcccgcgcggccgcaacctgccggcggcaccggcttccgcgccggccgcctcgcccaag
gaccgcaagcccgcggtcaagcccaatcccaagcctgcgcccaaaccggcacgggccgct
ccctga

DBGET integrated database retrieval system