KEGG   Ralstonia pseudosolanacearum: CDC45_12015Help
Entry
CDC45_12015       CDS       T05645                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpu  Ralstonia pseudosolanacearum
Pathway
rpu00620  Pyruvate metabolism
rpu00680  Methane metabolism
rpu01100  Metabolic pathways
rpu01120  Microbial metabolism in diverse environments
rpu01200  Carbon metabolism
Module
rpu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDC45_12015
  09102 Energy metabolism
   00680 Methane metabolism
    CDC45_12015
Enzymes [BR:rpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CDC45_12015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase AAA_22 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AST27885
UniProt: A0A223GPC5
LinkDB All DBs
Position
2558102..2561059
Genome map
AA seq 985 aa AA seqDB search
MTQSAARRASSRATPARKTPPAPASQTPAPSPGGTAGTALGPTSRRSSGSAAAKDQPLKE
DIRFLGRLLGDVLREQEGAAAFETVETIRQTAVRFRRDGDRQAEQELDRLLKTLSRDQTT
SVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSSPQPGSLLRALLSAADEGLSGDALRRF
FDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDAPLTVRERERNVTLLRAHVTKLW
QTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVATVFPRRGARGEPAPLPA
FFQMGSWIGGDRDGNPFVTAQTLRHAAQRQASVILTWYLDEIHALGAELSMSTLLVDVSA
DLLALAERSPDHSEHRADEPYRRALIGVYARLAATCRELTGEDAGRHAVGPAPAYTRAEE
LRADLQIVIDSLAAHHGEALADARLASLARAIDVFGFHLASIDLRQVSDVHEATVAELLR
VAGVEGAYAALSEADKRTLLLRELQQPRLLTLPFHTYSETTASELDIFRAAREVRARYGS
RIVRNYIISHTETLSDLLEVMLLQKEAGMFRHGTNGSGGAGLDVMVIPLFETIEDLRNAP
QIMGELLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNWELYKTELALVELFERKG
VRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIISSKFANPEIGRRNLE
TIVAATLEATLLPTRNRPKGLEEFEAAMQALSDHAFSAYRHLVYETPGFKDYFFATTPIT
EIADLNLGSRPASRKLMDRKQRRIEDLRAIPWGFSWGQCRLLLPGWFGFGSAVQRWLDEA
GSAKAKAARLATLKRMHKQWPFFANLLSNMDMVLSKADLNVASRYAQLCEDRKLRNAVFS
RISAEFTLTEQVLGAITGQSERLADNPLLARSIKNRFPYLDPLNHLQVELLKRFRSGKAG
SNDARVRRGIHLSINGIAAGLRNSG
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagtccgccgcgcgccgcgcatcctcgcgcgcgacccccgcgcgcaagacgcca
cccgcccccgccagccagaccccggcgccctcgcccggcggcacggccggcaccgccctg
ggcccgacctcgcgccggtcctccggcagcgcggcggccaaggaccagccgctcaaggag
gacatccgcttcctcgggcgcctgctgggcgacgtgctgcgcgagcaggaaggcgccgcc
gccttcgagaccgtcgagaccatccgccagaccgcggtgcgcttccgccgcgacggcgac
cgccaggccgagcaggagctcgaccggctgctcaagacgctgtcgcgcgaccagaccacc
tcggtggtgcgcgccttcagctacttctcgcacttggccaacatcgccgaagaccagcac
cataaccgccgccgccgcgtgcacgcgctggccggctcgtcgccgcagccgggcagcctg
ctgcgcgcgctgctgtcggcggccgacgagggcctctcgggcgatgcgctgcggcgcttc
ttcgacgccgcgctgatcgtgccggtgctgacggcccacccgaccgaagtgcagcgcaag
agcattctcgacgcgcagcgcgagatcgcccgcctgctggccgagcgcgatgcgccgttg
accgtgcgcgagcgcgagcgcaacgtcaccctgctgcgcgcccacgtcaccaagctgtgg
cagacgcgcatgctgcgcaccacgcgcctgatggtggccgacgagatcgagaacgcgctg
tcgtactaccagaccaccttcctgcgcgagattcccgcgctgtaccgcgagctggaagag
gacgtcgccacggtgttcccgcgccggggcgcgcgcggcgagccggccccgctgcccgcc
ttcttccagatgggctcgtggatcggcggcgatcgcgacggcaacccgttcgtcaccgcg
cagacgctgcgccatgccgcgcaacggcaggccagcgtgatcctcacgtggtacctcgac
gagatccacgcgctgggcgcggagttgtcgatgtccaccttgctcgtcgacgtgagcgcc
gacctgctggccctggccgaacgctcgcccgatcactccgagcaccgcgcggatgagcct
taccggcgcgcgctgatcggcgtgtatgcgcgcctggcggccacctgccgcgagctgacc
ggcgaggatgccggccgccacgcggtcggcccggcccccgcctacacgcgcgcggaggaa
ctgcgcgccgatctccagatcgtcatcgattccctcgcggcgcaccacggcgaggcgctg
gccgatgcgcggctggcctcgctggcgcgggcgatcgacgtgttcggcttccacctcgcg
tcgatcgatctgcgccaggtgtcggacgtgcacgaggccaccgtggccgagctgctccgg
gtggccggcgtggaaggcgcctatgcggcgctgtcggaagccgacaagcgcacgctgctg
ctgcgcgagctgcagcagccgcgcctgctgacgctgcccttccacacctacagcgagacg
accgcgtcggagctcgacatcttccgtgccgcgcgcgaggtgcgcgcgcgctacggcagc
cgcatcgtgcgcaactacatcatctcgcacaccgagacgctgtcggacctgctggaagtg
atgctgctgcagaaggaggcgggcatgttccgccacggcaccaacggcagcggcggcgcg
ggcctggatgtgatggtgatcccgctgttcgagaccatcgaagacttgcgcaacgccccg
cagatcatgggcgagctgctcgccctgcccggcttcgatgccgtgctggccgcgcagggc
aacgagcaggaagtgatgctcggctattcggattccaacaaggacggcggcttcctgacc
tccaactgggagctgtacaagaccgagctggcgctggtggagctgttcgagcgcaaaggc
gtgcgcctgcgcctgttccacggccgcggcggcacggtgggccgcggcggcggcccgacc
taccaggccatcctgtcgcagccgccgggcacggtgaacgggcagatccgcctgaccgag
cagggcgagatcatctccagcaagttcgccaaccccgagatcgggcggcgcaacctcgag
accatcgtggccgccacgctcgaagccacgctgctgcccacgcgcaaccggcccaagggg
ctggaggaattcgaggccgcgatgcaggcgctgtcggaccacgcgttctcggcctaccgc
cacctcgtctacgagaccccgggcttcaaggactacttcttcgccaccacgcccatcacc
gagatcgccgacctgaacctcggctcgcggccggcctcgcgcaagctgatggacaggaag
cagcgccgcatcgaagacctgcgcgcgattccgtggggcttctcgtggggccagtgccgg
ctgctgctgccgggctggttcggcttcggcagcgcggtgcagcgctggctggacgaggcc
ggcagcgccaaggcgaaggcggcgcgcctggcgacgctcaagcgcatgcacaagcaatgg
ccgttctttgccaacctgctctccaacatggacatggtgctgtccaaggccgacctgaac
gtggcttcgcgctatgcccagctgtgcgaagaccgcaagctgcgcaacgcggtgttctcg
cgcatctcggccgagttcacgctcaccgagcaggtgctgggggccatcaccggccagtcg
gagcggctggcggacaacccgctgctggcgcgctcgatcaagaaccgcttcccctacctc
gatccgctcaaccacctgcaggtggagctgctcaagcggttccgttcgggcaaggccggc
agcaacgatgcgcgcgtgcggcgcggcatccacctgtcgatcaacgggatcgcggcgggg
ctgcgcaatagcggctga

DBGET integrated database retrieval system