KEGG   Ralstonia pseudosolanacearum: CDC45_13515Help
Entry
CDC45_13515       CDS       T05645                                 

Definition
(GenBank) [glutamate--ammonia-ligase] adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
rpu  Ralstonia pseudosolanacearum
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDC45_13515
Enzymes [BR:rpu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     CDC45_13515
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     CDC45_13515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AST28165
UniProt: A0A223GQ60
LinkDB All DBs
Position
complement(2859696..2862563)
Genome map
AA seq 955 aa AA seqDB search
MTAQAPLSVAPFLQTPACPSEAPGAVLPFSLNYSRYVQRLAQARAGWAERVQAAAAGPIS
VAWLSARFGELFEAAAAEPEQALKRALRLLRNEVFAALAERDLSGAATLDEVTGAMTDFA
EFAVRAAIAVIGQELGALHGQPVGQSSGEVQELVVVGMGKLGGRELNVSSDIDLIFLYDE
EGDTQGGPRPLSNHEYFTKLGRRLINALADVTEDGYVFRVDMRLRPNGDAGPLACSLGML
EEYFVVQGREWERYAWIKGRVITDPGSPHAARVIQQLERVTTPFVFRRYLDYGVIAAIRA
LHAQIRAEAAKRSNAANRQHGGHDSQVQAHAPNIKLGRGGIREIEFVAQVFQLIRGGQDF
GLRIRPTLEVLRAAAERGLIGADAVARLTDAYRFLRQLEHRLQYVDDAQTHNLPGAPEDQ
LRIARMMGFADYAALVAQLERYQDEVAQQFEQTFSDKQDNQPPCAAIWHADLLDDERTES
ARAQLLELGYADADSVLERLRASRHSPRYRALSEVSRQRFDLLINRALDHAARQTDADVT
IARFLDFFDAISRRSSYLSLLSEYPQAMARVAHTLHASRWAADYLTRHPQLLDELLDTEA
LSAAPDWQGFRERVRERLRAAGDHVEMQMDILRQEHHAETFRILLQDLQGMLTVEPISDR
LSDLADAVLDLTLETVWQQVSTRHREVPRFAVVAYGRLGGKELGYASDLDLIFLYDDDDE
RAPEVYAAYARKLITWLTSHTAAGMLFDVDTRLRPNGAAGLMVTHFEAFRRYQMREGDNA
AWVWEHQALTRARFCAGDPEIGARFEALRIAVLRQPREAGPLRDEIAAMRERVLEGHANP
TPLFDLKHDRGGMVDIEFTVQFLVLLHSAAYAELTRNAGNIALLRMAGELGLIDAARAAR
VADAYRDFRARQHKLRLDGQSAARVPAGTCAHEAAHVRALWEQVFGSIDAASPTP
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaagctcccctgtccgttgccccgttcctgcagacgccggcttgcccgtcc
gaggcgccgggtgccgtgctgccgttctcgctcaactattcgcgctatgtccagcgactg
gcgcaggcgcgcgccggctgggcggagcgggtgcaggccgcggccgccggtccgatcagc
gtggcctggctgtcggcccgcttcggcgagctgttcgaggccgctgccgcggagcccgag
caggcgctcaagcgcgcgctgcggctgctgcgcaacgaggtgttcgcggcgctggcggag
cgcgatctgtccggcgccgccacgctcgacgaggtgaccggcgccatgaccgacttcgcc
gagtttgccgtgcgcgccgccatcgccgtgatcggccaggagctgggcgcgctccacggc
cagcccgtcggccagtcgtcgggcgaggtgcaggagctggtggtggtcggcatgggcaag
ctgggcgggcgcgagctgaacgtgtcgtccgatatcgatctgatctttctctacgacgaa
gagggtgacacgcagggcgggccgcgcccgctgtccaaccatgaatatttcacgaagctt
ggccggcggctgatcaacgcgctggccgacgtgaccgaagacggctatgtcttccgcgtc
gacatgcgcctgcggcccaacggcgatgccggtccgctcgcctgcagcctggggatgctg
gaggaatatttcgtcgtccagggccgcgagtgggagcgctatgcgtggatcaagggccgc
gtcatcaccgatccgggcagcccgcacgcggcccgcgtgatccagcagctcgagcgggtg
accacccccttcgtgttccgccgctacctcgactacggcgtgatcgcggcgattcgcgca
ctgcacgcgcagatccgcgcggaggccgccaagcgcagcaacgccgccaatcgccagcat
ggcgggcacgacagccaggtgcaggcgcacgcgcccaacatcaagctcgggcgcggcggc
atccgcgagatcgaattcgtcgcgcaggtgttccagctgatccgcggcgggcaggatttc
ggcctgcgcatccggccgacgctggaggtgctgcgcgcggccgccgagcgcggcctgatc
ggcgccgacgccgtcgcccgcctgaccgacgcctaccgcttcctgcgccagctcgagcat
cggctgcagtacgtcgacgatgcccagacgcacaacctgccgggcgcgccggaggaccag
ctgcgcattgcccgcatgatgggcttcgccgactacgccgcgctggtggcgcagctggag
cgctatcaggacgaggtggcccagcagttcgagcagaccttttccgacaagcaggacaat
cagccgccgtgcgccgccatctggcacgccgatctgctcgacgacgagcgcaccgaaagc
gcccgcgcgcagctgctcgagctcggctacgccgatgccgacagcgtgctggagcggctg
cgcgcctcgcgccattcgccgcgctaccgcgcgctgtcggaggtcagccgccagcgcttc
gacctgctgatcaaccgcgcgctcgaccatgccgcgcggcagactgatgccgatgtcacc
atcgcgcgcttcctggattttttcgatgcgatcagccgccgttcgtcgtacctgtcgctg
ctgagcgaatacccgcaggcgatggcgcgcgttgcccacacgctgcacgcttcgcgctgg
gcggccgattacctgacgcgccatccgcaactgctggacgaactgctcgacaccgaagcg
ctgtccgccgcgcccgattggcagggcttccgcgagcgcgtgcgcgaacgcctgcgcgcc
gccggcgaccatgtcgagatgcagatggacatcctgcgccaggagcaccatgcggagact
ttccgcatcctgctgcaggacctgcagggcatgctcaccgtcgagccgatcagcgaccgc
ctgtccgacctggccgacgccgtgctcgacctgacactggagacggtgtggcagcaggtg
tccacgcgccaccgcgaggtgccgcgcttcgcggtggtcgcctatgggcgcctcggcggc
aaggagctcggctatgcctccgacctcgacctgatcttcctctacgacgatgacgatgag
cgcgcgcccgaagtctatgccgcctacgcgcgcaagctgatcacctggctgaccagccac
acggccgccggcatgctgttcgatgtcgacacgcggctgcggcccaacggcgccgccggc
ctgatggtcacccacttcgaggcgttccgccgctatcagatgcgcgagggcgacaacgcc
gcctgggtgtgggagcaccaggcgctcacccgcgcccgcttctgtgcgggcgaccccgag
atcggcgcgcgcttcgaggcgctgcgcattgccgtgctgcgccagccgcgcgaggccggc
ccgctgcgcgacgagatcgcggccatgcgcgagcgcgtgctggaaggtcacgccaatccg
acgccgctgttcgatctcaagcacgaccgcggcggcatggtcgatatcgaattcaccgtg
cagttcctggtgctgctgcacagcgccgcctacgccgagctcacgcgcaatgccggcaac
atcgcgctgctgcgcatggcgggcgagctgggcctgatcgatgccgcgcgcgccgcccgc
gtggccgatgcctaccgcgatttccgcgcgcgccagcacaagctgcgcctggacgggcag
tccgccgcgcgcgtgccggccgggacctgcgcgcacgaggcggcccatgtgcgggcgctg
tgggagcaggtgttcggcagcatcgacgcggcgtcgcccacgccatga

DBGET integrated database retrieval system