KEGG   Ralstonia pseudosolanacearum: CDC45_14640Help
Entry
CDC45_14640       CDS       T05645                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rpu  Ralstonia pseudosolanacearum
Pathway
rpu00071  Fatty acid degradation
rpu00280  Valine, leucine and isoleucine degradation
rpu00281  Geraniol degradation
rpu00310  Lysine degradation
rpu00360  Phenylalanine metabolism
rpu00362  Benzoate degradation
rpu00380  Tryptophan metabolism
rpu00410  beta-Alanine metabolism
rpu00627  Aminobenzoate degradation
rpu00640  Propanoate metabolism
rpu00650  Butanoate metabolism
rpu00903  Limonene and pinene degradation
rpu00930  Caprolactam degradation
rpu01100  Metabolic pathways
rpu01110  Biosynthesis of secondary metabolites
rpu01120  Microbial metabolism in diverse environments
rpu01130  Biosynthesis of antibiotics
rpu01212  Fatty acid metabolism
Module
rpu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CDC45_14640
   00650 Butanoate metabolism
    CDC45_14640
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDC45_14640
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDC45_14640
   00310 Lysine degradation
    CDC45_14640
   00360 Phenylalanine metabolism
    CDC45_14640
   00380 Tryptophan metabolism
    CDC45_14640
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CDC45_14640
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CDC45_14640
   00281 Geraniol degradation
    CDC45_14640
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDC45_14640
   00627 Aminobenzoate degradation
    CDC45_14640
   00930 Caprolactam degradation
    CDC45_14640
Enzymes [BR:rpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CDC45_14640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AST28370
UniProt: A0A223GQP7
LinkDB All DBs
Position
complement(3101646..3102422)
Genome map
AA seq 258 aa AA seqDB search
MSYQHILVETRGRVGLVTLNRPKALNALNDALMDELGAALLAFDADEGIGAMIITGSDKA
FAAGADIGAMADYDFATVYKNEYITRNWETIRRIRKPVIAAVAGYALGGGCELAMMCDII
LAADTARFGQPEIKLGTMPGAGGTQRLPRAVSKAKAMDLCLTARMMGADEAERAGLVSRV
IPADKLLDEALAAAETIAGFSLPTAMMIKESINAAYETTLSEGVRLERRLFHATFATEDQ
KEGMHAFLGKRQPAFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaacacattctggtcgaaacgcgcggtcgtgtcggccttgtcacgctcaac
cgccccaaggcgctcaacgcgctcaacgatgcgctgatggacgaactcggcgccgcgctg
ctcgccttcgatgccgacgagggcatcggcgccatgatcatcaccggtagcgacaaggcg
tttgcagctggtgcggacatcggcgccatggccgactacgacttcgccaccgtctataag
aatgaatacatcacgcgcaactgggaaaccatccggcgcatccgcaagccggtgatcgcc
gccgtggcgggctacgcgctgggcggcggctgcgagttggcgatgatgtgcgacatcatc
ctggcggcggacaccgccaggttcggccagccggagatcaaactcggcaccatgccgggc
gcgggcggcacccagcgcctgccacgcgccgtctccaaggccaaggccatggacctctgc
ctgaccgcgcgcatgatgggcgccgatgaagctgagcgcgccggcttggtttcacgcgtt
atccccgccgacaagctcctggatgaagccttggcggccgccgagaccatcgccggcttc
tccctgccgaccgccatgatgatcaaggagtcgatcaatgcggcatacgaaaccacgctg
agcgagggcgtgcgcctggagcgccgcctgttccacgccacatttgccacggaagaccag
aaagagggcatgcacgctttcctggggaagcggcaacctgctttcaaacaccgctaa

DBGET integrated database retrieval system