KEGG   Ralstonia pseudosolanacearum: CDC45_21990Help
Entry
CDC45_21990       CDS       T05645                                 

Definition
(GenBank) protein PopC
Organism
rpu  Ralstonia pseudosolanacearum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9
Motif
Other DBs
NCBI-ProteinID: AST29870
UniProt: A0A223GV20
LinkDB All DBs
Position
unnamed:complement(1102522..1105596)
Genome map
AA seq 1024 aa AA seqDB search
MPRDTPQTVPGHSPFWPLFFFTHNNKREARHDLARLSLTLMPILPRLFHRTSRTSSADTQ
RDARTPPNASPLHGEPGRTPRSRGELGRNLRLRSNAQTSGTPGTPARPQIRASASRTAPS
TPQHPQGTEGTRTVPNSPLHNDARVFRERADHTGLSAWRTEMLTRFIEHSRKHGLANDFE
QVRVYDRLSRAVDHLKSVLRMSGDSVQLKSLPVPELPDVTFEIAHLKNLETVDCDLHALP
ATLENLFLLETLSLKGAKNFKALPDAVWRLPALQELKLSETGLKSLPPVGGGSALQRLTI
EDSPLEQLPAGFADLDQLASLSLSNTKLEKLSSGIGQLPALKSLSLQDNPKLERLPKSLG
QVEELTLIGGRIHALPSASGMSSLQKLTVDNSSLAKLPADFGALGNLAHVSLSNTKLRDL
PASIGNLFTLKTLSLQDNPKLGSLPASFGQLSGLQELTLNGNRIHELPSMGGASSLQTLT
VDDTALAGLPADFGALRNLAHLSLSNTQLRELPANTGNLHALKTLSLQGNQQLATLPSSL
GYLSGLEELTLKNSSVSELPPMGPGSALKTLTVENSPLTSIPADIGIQCERLTQLSLSNT
QLRALPSSIGKLSNLKGLTLKNNARLELLSESGVRKLESVRKIDLSGCVRLTGLPSSIGK
LPKLRTLDLSGCTGLSMASLPRSLVLPRDGLNVIFPEHLKTDVGNARIQQNPRARLLEGH
LERQNEAMNHAMFGDDESVGSMTSVPDNEAGVVSMAFHAKHAYKRLERLRQEAGSSMAAP
MRNNDAESMRRALAYAFRSMSDLPTFKKLDNAARSLSYEVQEQLADLVAAPVGQKLVKAI
AEGAYGAGRDARAIEQMLPELATRIANHPEIQQLREQAKRYPSSLPPEKLAAKLTPLIQP
LWDGTRAVAPMPGQLRQALQDLLVTAEGRQLASEIDRAAHSHRAGDEGKALRGLLPVLAA
KIGSDPRVVRVREFVSRHTFGSPQQRAESLAQTLTPVVQELWAQTQAEVAKQGQTPAASP
SRQR
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgccccgggatacgccacaaacggttccggggcattcgcccttttggcccctgtttttt
ttcacccacaacaacaagcgtgaggcacgacatgaccttgcgcgacttagcctgacgctc
atgcctatccttccacgcctattccatcgaacatcgcgcacgtcgtccgccgacacgcaa
cgcgacgccaggacaccgccgaacgcctcgccgctgcatggagaaccgggacggaccccg
cgctcaagaggggagcttggccgcaacctgcgtctgcgcagcaacgcgcagacgagcggc
acccctggcactccggcacgcccccagatccgcgcctcggcgtcgcgcaccgcaccgagc
accccacagcacccgcagggaaccgaaggcactcgcacggttccgaacagcccgttgcac
aacgatgctcgcgtgttcagagaacgcgcagaccacaccgggttgtcggcctggcgcacc
gagatgctgacccggtttatcgaacacagccgcaaacacggtttggccaacgacttcgag
caggtgcgggtctacgaccgactgtcgcgagccgtcgaccacctgaagagcgtcctccgg
atgagcggcgacagtgtccaattgaagtcgctccccgtccccgagctgccggatgtcacc
tttgagatcgcccacctgaagaacctcgagaccgtggattgcgatctgcacgcgttgcct
gccacgctggaaaatctgttcttgctggagaccttgtccttgaagggcgccaagaacttc
aaggccctgcccgatgccgtctggcgattgcccgcactgcaagagctgaagctctcggaa
acgggcctaaaatccctgccgccggtcggaggcggatccgcactgcagcggcttacgatt
gaagattcgccgctcgaacagcttccggccggattcgctgacctcgaccaacttgccagc
ctgtcgctgtcgaacacgaagctggagaaactgtcttccggcatcgggcagttgccggcg
ctgaagtccctctccctgcaggacaatccaaagctggagcggttgcccaagtcgctcggg
caggtggaagagctcacgctcatcggcggccgcattcatgcgctgccgtcggcgagcggg
atgtcgtcgttgcaaaagctcacggtggacaactcgtcgctggcaaagctgccggccgac
ttcggtgcgctcggcaatctggcccacgtgtcgctgtcgaatacgaagttgcgcgatctg
cccgcgagcatcgggaacttgttcacgctgaagacgctgtcattgcaggacaaccccaag
ctggggtcgctgcccgcttcgttcgggcaactgtccggtcttcaagagctgacactcaac
ggcaaccgcattcatgagctgccatcgatgggcggggcatcgtcattgcagacgctcacg
gtggatgacaccgcgctggccgggttgccggccgacttcggcgcgctccgcaatctggcc
catctgtccctgtcgaatacacagctgcgagagctgcctgcaaacaccgggaacctgcac
gcgctgaaaacgctgtcgttgcaaggcaaccagcaactggcgaccttgcccagctcgctt
gggtatttgtcagggctggaggagctgacgctcaagaacagcagcgtcagcgagctgcca
ccgatgggcccgggctccgcactgaagacgctcacggtggaaaattcacctctgacgtcg
attccggccgacatcggtatccagtgcgagcggctgacgcagttgtcgctgtcgaacacg
caactgcgcgccctgccctccagcatcggcaagttgtcgaatctgaaggggctgacgctg
aagaacaacgcccgccttgaattgctgtccgaaagcggagtccgcaagctggagtcggtg
aggaagatcgacctgtcgggttgcgtgaggctcaccggactgccctcttcgattggaaag
ctgccaaagctgaggacactcgacttgagcggctgcaccggcctgagcatggcaagcctg
ccgcgttcgctcgtgttgccgcgcgatgggctgaacgtcatctttccggagcacctgaaa
accgacgtgggcaatgcacgtattcaacagaatccacgtgcccggttgctggaaggccat
ctggagcgccagaacgaggcgatgaatcacgccatgttcggggacgacgagtcggtgggg
tcgatgacgagtgtgccggacaatgaagccggggtcgtgtcgatggccttccatgccaaa
catgcatacaagcgcctcgagaggctccggcaggaggccggcagcagtatggccgcaccg
atgaggaacaacgatgcggaatccatgcgcagagccttggcctatgcgttcaggagcatg
tccgatctgccgacgttcaagaaactggataacgcggcacgctcgctgtcttatgaggtc
caggagcaactggccgatctggtggccgcgcccgtggggcagaaactggtcaaggcgatc
gccgagggtgcctatggcgcggggcgggatgcccgggcgatcgagcagatgttgccggag
ctggcaacgcggatcgccaaccatccggagatccagcaactgcgggaacaggccaagcga
tacccgagcagcctgcctccggagaagctcgccgcaaaactaacgcccttgatccagccg
ctctgggacggcacacgggcggtggcaccgatgccaggccaactgcgtcaagcgctgcaa
gacctgctcgtcaccgctgaggggcgtcaactggccagcgagatcgaccgggcggcgcac
agtcaccgcgcgggggatgaggggaaggcgctgcgtggtctcctgcccgttctggccgcc
aagatcggctcggaccctcgcgtcgttcgggtgcgggaattcgtgagccggcacacgttc
ggcagtccgcaacagcgcgcggaaagccttgcgcagacgctgaccccggtcgttcaggaa
ctctgggcgcaaacgcaagccgaggtggcgaagcaaggccagacgcccgcggcaagtccg
tcgaggcagcgttga

DBGET integrated database retrieval system