KEGG   Ralstonia pseudosolanacearum: CDC45_22360Help
Entry
CDC45_22360       CDS       T05645                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rpu  Ralstonia pseudosolanacearum
Brite
KEGG Orthology (KO) [BR:rpu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDC45_22360
Enzymes [BR:rpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     CDC45_22360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ThiF
Motif
Other DBs
NCBI-ProteinID: AST29938
UniProt: A0A223GV61
LinkDB All DBs
Position
unnamed:1193522..1194559
Genome map
AA seq 345 aa AA seqDB search
MMDALVIHAANDLRIEDIDTPEVQPDQLRVQVRFGGICGSDLHYYNHGGFGTVRVKEPMV
LGHEVAGRVEEIGPGVHRHAKGDRVAISPSRPCGQCHYCQQGLQNHCLDMRYYGSAMRTP
HVQGAFRREIVIDESQAHRLADTLSDQEGAMAEPLSVALHAVRRAGPLLGKRVLVTGCGP
IGALIVVAARRAGAAEIIVTDMGAYPLKAAVAVGADVTINVAEQPDGLKPYTTDKGQIDV
LFEASGNERALRGAIDALRPRGIIVQVGLGGEMTLPLNAIVAKELELRGAFRFHEEFAMA
VELLNKGLVDVKPLISATVPYRNAAHAFALAGDRTQAMKVLLDFQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atcatggacgctctcgtcattcacgccgccaacgacctgcgcatcgaggacatcgacacc
cccgaggtgcagcccgatcaactgcgcgtgcaggtgcgctttggcggcatctgcggctcc
gacctgcactattacaaccacggcggcttcggcaccgtgcgcgtcaaggaaccgatggtg
ctgggccacgaggtggcgggccgcgtggaagaaatcgggcccggcgtgcaccggcatgcc
aagggcgatcgggtcgccatcagcccgagccggccctgcggccagtgccactattgccag
caaggcctgcagaaccattgcctggacatgcgctactacggcagtgccatgcgcacgccc
cacgtgcaaggcgcgttccgccgagagatcgtcatcgacgaaagccaggcgcatcgtctt
gccgacaccctcagcgaccaggaaggggcaatggctgagccgttgtccgtggcgctgcat
gccgtgcgccgcgccggcccgctgctgggcaagcgcgtgctggtgaccggctgcggcccc
atcggcgcattgatcgtggtggcggcgcggcgcgcgggggccgccgagatcatcgtcacg
gacatgggtgcctatccgctgaaggccgccgtcgcggtgggcgccgacgtcacgatcaac
gtcgcggaacagcccgacgggctcaagccgtacaccaccgacaagggacagatcgacgtg
ttgttcgaggccagcggcaacgagcgcgcactgcgcggcgccatcgatgcgctgcgcccg
cgcggcatcatcgtgcaggtggggctgggcggcgagatgacgctgcccctcaacgccatc
gtcgccaaggaactcgagctgcgtggcgccttccgctttcacgaagagttcgccatggcg
gtcgagctgctgaacaagggcctggtcgacgtcaagccgctgatttccgctaccgtgccc
taccgcaatgcggcccatgcgtttgcgcttgctggcgaccgcacacaggcgatgaaagtc
ctgctggattttcaatga

DBGET integrated database retrieval system