KEGG   Rhizobium pusense CFBP5875: CFBP5875_08885
Entry
CFBP5875_08885    CDS       T06598                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rpus  Rhizobium pusense CFBP5875
Pathway
rpus00473  D-Alanine metabolism
rpus00550  Peptidoglycan biosynthesis
rpus01100  Metabolic pathways
rpus01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rpus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CFBP5875_08885
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CFBP5875_08885
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CFBP5875_08885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpus01011]
    CFBP5875_08885
Enzymes [BR:rpus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CFBP5875_08885
Peptidoglycan biosynthesis and degradation proteins [BR:rpus01011]
 Precursor biosynthesis
  Amino acid ligase
   CFBP5875_08885
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp_3 CPSase_L_D2
Other DBs
NCBI-ProteinID: QCL84656
LinkDB
Position
circular:complement(1738151..1739077)
AA seq 308 aa
MSGKHVAVLMGGFSSERPVSLSSGNACAQALEDEGYKVTRVDVGRDVAAVLDALRPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMDKAQAKKVAAAAGIPVAAERVMNR
FDFTSEHPLAPPYVVKPVREGSSFGVVIVKEDQSHPPQILTSSEWKYGDHVMVERYIHGR
ELTCGVLDGEALGVTEVVPLGHNFYDYDAKYAAGGSKHVIPAEISPKIYQKIQTLAVMAH
RAIGCRGVSRSDFRYDDRFSEDGEVIWLEVNTQPGMTPTSLVPEMAAHAGRSFGNLVSWM
VEDASCLR
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagcggcaagcacgtagctgttcttatgggtggattttcgtcggagcggccggtcagc
ctgtcgtcgggcaacgcttgcgcgcaggctctggaagacgagggctacaaggtcacccgt
gtcgatgtcggccgcgatgtcgccgccgtgcttgatgcgctgcgcccggacgtcgctttc
aacgcgctgcatgggcccttcggcgaagacggcaccattcagggcatcctcgaatatctc
gccattccctatacccattccggcgtgctcgcctcggcgcttgccatggacaaggcgcag
gccaagaaggttgctgctgctgccggcattcctgtcgccgccgagcgagttatgaaccgc
ttcgatttcaccagcgaacatccgctggcgccgccttatgtggtgaagccggtgcgcgaa
ggctcgagcttcggcgtcgttatcgtcaaggaagaccagtcgcacccgccgcagatcctc
acgtcctctgaatggaaatacggcgaccatgtcatggtcgagcgttatatccatggccgc
gaactgacctgcggggtgctcgacggcgaggcgctgggcgtcaccgaagtggtgccgctc
ggtcacaatttctatgattacgatgcgaaatacgctgctggtggctcgaaacatgtcatt
cccgcagaaatttcaccgaaaatttaccaaaaaattcaaacactggcggttatggcgcat
cgggcgatcgggtgccgtggcgtaagccgttcagactttcgttacgacgaccgtttctca
gaagatggcgaagttatctggcttgaagtgaatacacagccgggcatgacgccgacctcc
ctggtgcctgaaatggcggcccatgctggccgctcctttggtaaccttgtcagctggatg
gtggaggacgcttcgtgtttgcggtga

DBGET integrated database retrieval system