KEGG   Rickettsia prowazekii RpGvF24: MA7_01880Help
Entry
MA7_01880         CDS       T01793                                 

Definition
(GenBank) penicillin-binding protein DACF precursor (dacF)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
rpv  Rickettsia prowazekii RpGvF24
Pathway
rpv00550  Peptidoglycan biosynthesis
rpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MA7_01880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rpv01002]
    MA7_01880
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rpv01011]
    MA7_01880
Enzymes [BR:rpv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MA7_01880
Peptidases [BR:rpv01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   MA7_01880
Peptidoglycan biosynthesis and degradation proteins [BR:rpv01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   MA7_01880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase CytoC_RC
Motif
Other DBs
NCBI-ProteinID: AFE53396
LinkDB All DBs
Position
477942..478862
Genome map
AA seq 306 aa AA seqDB search
MFRRFLLPYIFILIFCFAPISEAKKIVKNTNKHPIQTSLVIDAKNGKVLQAHNAQVRIYP
ASLTKLMTLYLIFEAIESGKLSLDKKLLVSAKASKMPHCKLGLRAGDHITVREAINGLII
KSANDVAVTVAEGMKGSEKAFAHLMNVRAKTLGMKNTFFKNASGLHDPFQQTTARDIAKL
AIALKRDYPKYYPLFSKTHFVFRGNVVNGHNSVTKHYQGAEGMKTGFHTPAGYNLVTTAS
RNNKSLIAVITGGKSAASRDQKMMRLLDHHFGVKTITSKPSIKLASNNKANTKAKSKIIK
RKNIRS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagatttttactaccttatatctttattttaatattttgctttgctcctata
agcgaagcaaaaaaaattgtaaaaaataccaataaacatcctatccaaactagtttagta
attgacgcaaaaaatggtaaagttttgcaagcacataatgcacaagtgcgaatttatccc
gcttctttaactaagttaatgactctatatttaatatttgaagcaattgaatcaggtaag
ttatctttagataaaaaattacttgtatcggcaaaagcttcaaaaatgccgcattgtaaa
cttggtttaagagcaggtgaccatataaccgttagagaggcaattaatggattaataata
aaatctgctaatgatgttgcagtaactgttgctgagggtatgaaaggttcagaaaaagct
tttgctcatttaatgaatgtgagagctaaaacattaggtatgaaaaacacattttttaaa
aatgcttcaggtttgcatgatccatttcaacaaactaccgcaagagatatagctaaactc
gctattgcacttaaaagagattaccccaaatattatccattattttctaaaactcatttt
gtatttcgtgggaatgtagtaaacggacataatagtgttactaaacattatcaaggtgct
gaaggtatgaaaacaggatttcatactcctgcaggttataatttagtaacaactgcttct
cggaataataaatcattgattgcagttattactggcggtaaaagtgcagcatctcgtgat
caaaaaatgatgaggttattagatcaccattttggtgttaaaactataacttctaaacct
tcaatcaaacttgcctctaataataaagctaatacaaaagcgaaatcaaaaataataaag
agaaagaatatacgtagttga

DBGET integrated database retrieval system