KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_0023Help
Entry
Rpdx1_0023        CDS       T01381                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rpdx1_0023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpx02000]
    Rpdx1_0023
Enzymes [BR:rpx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rpdx1_0023
Transporters [BR:rpx02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rpdx1_0023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ADU41668
UniProt: E6VE55
LinkDB All DBs
Position
25714..26382
Genome map
AA seq 222 aa AA seqDB search
MLTVHHLNNSRSQRVLWLLEELGTPYEIKRYQRQPDMMAPKELRAVHPLGKSPVITDNGN
TVAESGAIIEYIVGTYGDGRLIPPPNTPERLRYTYWLHYAEGSAMPPLLLKLLFSMMPKR
APALVRPLVKMVASGALTGFVDPQLKLHMDYWESELGKAAYFAGDEFTAADIQMSFPLEA
AASRGGLDQRYPKALAWLERIHARPAYNRALEKGGPYEIGKA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccatcatctcaacaattctcgctcgcaacgtgtgctgtggctcctggag
gagctcggcaccccttacgagatcaagcgctatcaacggcagccggacatgatggccccc
aaggagctgcgcgccgtccatccgctcggcaagtcgccggtgatcaccgacaacggcaac
accgtcgccgagtccggcgccatcatcgaatacatcgtgggcacctacggggacggccgg
ctgatcccgccgccgaacaccccggagcggctgcgctacacctattggctgcattacgcc
gagggctcggcgatgccgccgctactgctgaagctgctgttctcgatgatgcccaagcgt
gccccggcgctggtacgcccattggtgaagatggtggcgtccggcgcgctgacaggtttc
gtcgatccgcagctcaagctgcacatggactattgggagagcgaactcggcaaggctgcc
tatttcgccggcgacgagttcaccgccgccgacatccagatgagcttcccgctggaagcc
gccgcctcacgcggcggtctcgaccagcgctacccgaaggcgctggcctggctggagcgc
atccacgcccgccccgcctacaatcgcgcgctggaaaaaggcgggccttacgagatcggg
aaagcgtag

DBGET integrated database retrieval system