KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_1172Help
Entry
Rpdx1_1172        CDS       T01381                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
rpx  Rhodopseudomonas palustris DX-1
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Rpdx1_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF2053
Motif
Other DBs
NCBI-ProteinID: ADU42798
UniProt: E6VE67
LinkDB All DBs
Position
1250332..1251096
Genome map
AA seq 254 aa AA seqDB search
MSIILDPWFYAVAIPAVFLLGLAKGGFSGVGIAATPLLALYLPPLEAAGLLLPVLITQDL
ISLYVYRRHWDARSLKVMLPGAVLGMGIAWWTASIVSDDAVRLIVGGVGLAFVLNVWLRP
RASAVKLSDAAGVFWGTVSGFTSFMTQGGGPPYQVYMLPQLLPKLVLVGTTTIFFAIVNA
LKIGPYFLLGQFTPANLGTSLALLPLAAAANMAGIWLVKRTPTDLFYRIAYTLLFVVSVA
LLYQGLSNLLRGTV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatcatcctcgatccctggttctacgccgtcgcaatccccgccgtgttcctgctc
ggactcgcgaaaggaggcttctccggcgtcggcatcgcggcgaccccgctgctggcgctg
tatctgccgccgctcgaggcggccggattgttgctgccggtgctgatcacccaggatctg
atttcgctctacgtctatcggcgccattgggacgcgcgcagtttgaaggtgatgttgccc
ggcgcggtgctcggaatggggatcgcctggtggaccgcctcgatcgtgtcggacgatgcg
gtgcggctgatcgtcggaggcgtcgggctggcgttcgtgctcaacgtctggctgcggcca
agggcgtcggcggtgaagctgtcggatgcggccggcgtgttctggggcacggtgtccggc
ttcacctcgttcatgacgcaaggcggcggcccgccgtatcaggtctacatgctgccgcag
ctcctgccgaagctggtgctggtcggcaccaccacgatcttctttgcgatcgtcaatgcg
ctgaagatcggtccgtatttcctgctggggcagttcaccccggccaatctcggcacctcg
ctggcgctgctgccgctcgcagccgccgccaatatggccgggatctggctggtgaaacgg
acgccgaccgacctgttctaccggatcgcctatacgttgctgttcgtggtgtcggtggcg
ctgctctaccagggcctttcgaatctgctgcgcgggacggtgtga

DBGET integrated database retrieval system