KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_2602Help
Entry
Rpdx1_2602        CDS       T01381                                 

Definition
(GenBank) molybdenum cofactor synthesis domain protein
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00790  Folate biosynthesis
rpx01100  Metabolic pathways
Module
rpx_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rpdx1_2602
Enzymes [BR:rpx01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     Rpdx1_2602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ADU44189
UniProt: E6VGP9
LinkDB All DBs
Position
complement(2788738..2789949)
Genome map
AA seq 403 aa AA seqDB search
MALMPVDDALAAVLAGARGLDTELVALEDGHGRVLAEDLAALRTQPPQPMSAMDGYAVRA
ADVAAPPAILRVIGEIAAGRPETVGIGAGEALRIFTGGVVPDGADAVVIQEDTERNGDRV
TVNEAVRPGRHIRPAGIDFREGEILLHRGHRLRDRDLALAAGMNHPSLPVHRRPRLAMLA
TGDELVMPGTTPGPGQIVYSNGYALRALAHAEGAEVIDLGIAADTLEATRAAIRRAHELD
ADLLVTTGGASAGDHDLVKGALEAEGTEISFWKIAMRPGKPMMHGRLGAMRVIGLPGNPV
SSYVCAVLFMVPLVRALCGISQPGHVRQPALLGADLSANDQREDYLRATLSIGDDGRPVA
TPVDSQDSSLLARLAAAQALIVRPAFAPAARAGSPCLIVKLSL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggccttgatgccggtcgacgatgcgctcgccgccgtgctcgcgggcgcgcggggcctc
gacaccgaactggttgcactcgaggacggccacggccgggtgctggccgaagacctcgcc
gcactgcggacccagccaccgcagccgatgtcggcgatggacggctatgcggtgcgcgcc
gccgacgtcgcagccccgcccgcgatcctgcgggtgatcggcgagatcgcagccggccga
cccgagacggtagggatcggtgccggcgaggcgctgcggatcttcaccggcggcgtggtg
ccggacggcgcagacgcggtggtgatccaggaggacaccgagcgcaacggcgaccgcgtc
accgtcaacgaagccgtcaggcccggccgccacatccgccccgcagggatcgattttcgc
gaaggcgagatcctgctgcatcgcggccaccggctccgcgaccgtgacctcgcgctcgcc
gccggcatgaatcacccgtcgctgccggtgcatcgccggccgcggctggcgatgctggcg
acgggcgacgaactggtgatgccggggacgacgcccggcccgggtcagatcgtttattcc
aacggttacgcgttgcgcgccctggcgcacgcagaaggcgccgaggtgatcgatctcggc
atcgccgccgacacgctggaggcgacgcgagcggcgatccgccgagcgcacgagctggac
gccgaccttctggtcaccaccggcggcgcctcggccggcgaccacgacctggtcaaaggc
gcgctcgaggcagagggcaccgaaatctcgttctggaagatcgcgatgcgtcccggcaag
ccgatgatgcacggccgtctcggagcgatgcgggtgatcggcctgcccggcaatccggtg
tcgtcctatgtctgcgcggtgctgttcatggtgccgttggtccgcgcgctgtgcggcatc
agccagcccgggcacgtccgccagccggcgttgctcggcgccgacctctccgccaacgac
cagcgcgaggactatttgcgcgccaccctgtcgatcggcgatgacggccggccggtcgcg
accccggtcgacagccaggactcctcgctgctggcgcggctggcagcggcacaagcgctg
atcgtccggccggccttcgcgccggctgcacgcgccgggtcgccctgcctcatcgttaag
ttatcgctgtag

DBGET integrated database retrieval system