KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3074Help
Entry
Rpdx1_3074        CDS       T01381                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00061  Fatty acid biosynthesis
rpx00620  Pyruvate metabolism
rpx00640  Propanoate metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
rpx01120  Microbial metabolism in diverse environments
rpx01130  Biosynthesis of antibiotics
rpx01200  Carbon metabolism
rpx01212  Fatty acid metabolism
Module
rpx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpdx1_3074
   00640 Propanoate metabolism
    Rpdx1_3074
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rpdx1_3074
Enzymes [BR:rpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Rpdx1_3074
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Rpdx1_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADU44655
UniProt: E6VMQ3
LinkDB All DBs
Position
3273601..3274953
Genome map
AA seq 450 aa AA seqDB search
MFDKILIANRGEIALRVLRACKELGIATVAIHSTADADAMHVRLADESVCIGPPPSKDSY
LNVPALLAACEITGADAVHPGYGFLSENARFAEILADHNLHFIGPKAEHIRLMGDKIEAK
KTAKRLGIPVVPGSDGAVGPDDDAMAIAQSIGFPVLVKAAAGGGGRGMKVAHTADDLALA
ISTAGNEAKAAFGDASVYLEKYLQKPRHIEIQILGDGRGGAIHLGERDCSLQRRHQKVWE
ESPSPVISAEARARIGGICAKAMQDMQYLGVGTIEFLYEDGEFYFIEMNTRIQVEHPVTE
MITGIDLVLEQIRIAAGGDLPVTQDEITLNGHAIECRVNAENPVTFRPSPGKIARYHPPG
GLGIRIDSAVFQGYTIPPYYDSLVGKLIVHGKTRGECLMRLRRALDEMVVDGVETTLPLF
RALVREPSIIDGDYHIHWLEQYLASGVPQG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaagatcctgatagctaatcgcggcgagatcgccctgcgcgtgctgcgcgcc
tgcaaggagctgggcatcgccacggtcgcgatccactccaccgccgacgccgacgccatg
cacgtccgcctcgccgacgaaagcgtatgcatcggcccaccgccgtccaaggacagctat
ctcaacgtcccggcactgctcgccgcttgcgagatcaccggtgccgatgcggtgcatccc
ggctacggcttcctgtccgaaaacgcccgcttcgccgaaatcctcgccgatcacaatctg
cacttcatcggccccaaggccgaacacatccggctgatgggcgacaagatcgaggccaag
aagaccgccaaacgtctcggtatcccagtcgtgcccggctccgacggcgcggtcggcccg
gatgatgacgcgatggcgatcgcccagtcgatcggcttcccggtgctggtcaaggcggcg
gcgggcggcggcggccgcggcatgaaggtcgcccacaccgccgacgatctggcgctggcg
atctcaactgccggtaacgaagccaaagcagcgttcggcgacgcctcggtctatctggaa
aagtacctgcagaagccacgtcacatcgagatccagatccttggcgacgggcgcggcggc
gcgatccatctcggagagcgcgactgctctttgcagcgccggcatcagaaggtgtgggag
gaaagcccctcaccggtaatcagcgccgaggcgcgcgcccggatcggcgggatctgcgcc
aaggcgatgcaggacatgcagtatctcggcgtcggcacgatcgagtttctttacgaggat
ggcgagttctacttcatcgaaatgaacacccgcattcaggtcgagcatccggtgaccgaa
atgatcaccggtatcgatcttgtgctggagcagatccgcatcgccgccggcggcgatctg
cctgtgacccaggatgagatcaccctcaacggccatgccatcgagtgccgggtcaacgcc
gagaacccggtgaccttccgcccgtctcccggcaagatcgcgcgctaccatccgccgggg
ggcctcggcatccggatcgattcagcggtattccaaggctatacgatccccccctactac
gactctctggtcggtaagcttatcgtccacggcaagacgcggggcgaatgcctgatgcgg
ctccgccgggcgttggacgagatggtggtggacggggtcgaaaccacactgcctctgttc
cgcgcgctggtacgagagccctcgatcatcgacggcgattaccatatccattggctcgag
cagtatctggcctcgggagtcccgcagggttga

DBGET integrated database retrieval system