KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3760Help
Entry
Rpdx1_3760        CDS       T01381                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00620  Pyruvate metabolism
rpx00680  Methane metabolism
rpx00710  Carbon fixation in photosynthetic organisms
rpx01100  Metabolic pathways
rpx01120  Microbial metabolism in diverse environments
rpx01200  Carbon metabolism
Module
rpx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpdx1_3760
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rpdx1_3760
   00680 Methane metabolism
    Rpdx1_3760
Enzymes [BR:rpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rpdx1_3760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADU45325
UniProt: E6VGS8
LinkDB All DBs
Position
complement(4030570..4033380)
Genome map
AA seq 936 aa AA seqDB search
MSSLNLSAGAEPVSERPDDAAAIEAETRLRNDIRLLGRILGDTVREQEGQSVFDLVENIR
QTSIRFHRDDDKTARAELAAILDGMSIPDTMRIVRAFSYFSHLANIAEDQNNIRQMRAGS
TAGSAPRAGLLAKTLAHARQEGISAAELRKFFATALVSPVLTAHPTEVRRKSTMDREMQI
ASLLDQRDRVQLTADEWADNEERLRRAVETLWKTNLLRRTKLTVLDEVTNGLSFYDYTFL
REVPRLHSALEDRLADAAKAEGVNSEGELASFLRMGSWIGGDRDGNPFVTAEVLHGTLKL
QSTRVLRYYLEELHELGSELSLASHLAGITDTVKALAEISPDTSPHRKYEPYRLAVSGIY
ARLAATALALEVENLRAPVGEAAPYASAQDFKADLDAIHLSLTQHNSGVIARGRLRQLRR
AIDCFGFHLACLDMRQNSAVHERTVGELMDAARPGTSYAVLDEEARIALLIAELRSTRPL
TSMFVKYSDETVGELSVFREAAKAHATYGAAAIPQCIISMTKGVSDLLEVAVLLKEVGLI
DPSGRSAINVVPLFETIEDLQACAKIMDRLLAIPEYRRLVDSRGSVQEVMLGYSDSNKDG
GFVTSGWELYKAEIGLIEIFEHHGVRLRLFHGRGGSVGRGGGPSYDAIVAQPGGAVNGQI
RITEQGEIITSKYSNVEVGRNNLEILAAATLEASLLQPKRVAPHRDYLEAMEQLSALAFK
AYRGLVYETDGFVDYFWASTVINEISTLNIGSRPASRKKTRAIEDLRAIPWVFSWAQCRL
MLPGWYGFGSAVSAWVTAHPDKGIAFLQKMYQEWPFFRTLLSNMDMVLSKSSIGIASRYA
ELVEDVDVRERIFGRIRAEWHSSIEYLFAIMQQDRLLQSNPLLERSIRHRFPYLDPLNHV
QVQLLREHRTHDPDEQVLRGVQLTINGISAGLRNSG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgctgaatctgtccgccggtgctgaaccggtctccgaacgtcctgacgacgcg
gccgcgatcgaggccgagacccggctgcgcaacgacatccggctgctcggccggatcctc
ggcgacaccgtgcgcgagcaggagggccagagcgtgttcgatctggtggagaacatccgc
cagacctcgatccgtttccatcgcgacgatgacaagaccgcgcgcgccgagctcgccgcc
atcctcgacggtatgtcgatcccggacacgatgcggatcgtgcgcgccttcagctacttc
tcgcacctcgccaacatcgccgaggaccagaacaacatccgccagatgcgcgccggctcg
accgccggatcggcgccgcgcgccggcctgctcgccaagacgctggcccatgcgcgccag
gaggggatcagcgctgccgagctgcgcaagttctttgcgacggcgctcgtcagcccggtg
ctgaccgcgcacccgaccgaagtgcgccgcaagagcacgatggaccgcgagatgcagatc
gcttcgctgctcgatcagcgcgaccgcgttcagctcaccgccgacgaatgggccgacaac
gaggagcggctgcgccgcgccgtcgagacgctgtggaagaccaacctcttgcgccggacc
aagctgacggtgctggacgaagtcaccaacggcctgtcgttctacgactacaccttcctg
cgcgaggtgccgcggctgcacagtgcgctggaggaccggctcgccgacgcggccaaggcc
gaaggcgtcaacagcgaaggcgagctggcgagcttcctgcggatgggaagctggatcggc
ggcgaccgcgatggcaatccgttcgttaccgccgaggtgctgcacggcaccttgaagctg
cagagcacgcgggtgctgcgctattatctcgaggagctgcacgagctcggctcggaattg
tcgttggcctcgcatctcgccggcatcaccgacaccgtcaaggcgctggccgaaatctcg
cccgacacctcgccgcatcgcaaatacgagccgtatcgcctcgcggtgtccggcatctat
gcgcggctcgccgccaccgcgctcgcgctcgaggtcgagaacctccgcgcgccggtcggc
gaggccgcaccttacgccagcgcgcaggacttcaaggccgatctcgacgccatccatctg
tcgctcacccagcacaattccggcgtgatcgcgcgcggccggctgcgccagctccgccgc
gcgatcgactgcttcggcttccacctcgcctgtctcgacatgcggcagaactcggccgtg
catgaacgcactgtcggcgagctgatggatgcggcgcggcccggcacctcttacgcggtg
ctcgacgaggaggcgcggatcgcgctgctgatcgccgagctgcgcagcacccggccgcta
acgtcgatgttcgtcaaatacagcgacgagaccgtcggcgaactttcggtgttccgcgaa
gccgcgaaggcgcacgcgacctacggcgcggcggcgatcccgcaatgcatcatctcgatg
accaagggcgtctcggacctcttggaagtcgcggtgctactcaaggaggtcgggctgatc
gatccgtccgggcgcagcgccatcaacgtggtgccactgttcgagacgatcgaggacctg
caggcctgcgccaagatcatggaccggctgctggcgattccggaatatcgtcggctggtc
gacagccgcggctcggtgcaggaggtgatgctcggctattccgatagcaacaaggacggc
ggcttcgtcacctcgggctgggagctttacaaggccgagatcggcctgatcgagatcttc
gagcaccatggcgtgcggttgcggctgttccatggccgcggcggctcggtcggccgcggc
ggcggcccgagctacgacgccatcgtggcgcagccgggcggcgcggtgaacggccagatc
cgcattaccgagcagggcgagatcatcaccagcaaatactccaacgtcgaagtcggccgc
aacaaccttgagatcctcgccgccgcgacgttggaagcaagcctgctgcagccgaagcgg
gtagcgccgcatcgcgactatctcgaagcgatggagcagctctccgcgctcgccttcaag
gcatatcggggcctggtgtacgagaccgacggattcgtcgactacttctgggcctcgacc
gtgatcaacgagatctcgacgctgaacatcggcagccgcccggcctcgcgcaagaagacg
cgcgcgatcgaggatctgcgcgcgatcccctgggtgttctcatgggcgcagtgccggctg
atgctgcccggctggtacggcttcggcagcgcggtgtcggcttgggtcaccgcgcacccc
gacaagggcatcgccttcctgcaaaagatgtatcaggagtggccgttctttcgcacgctg
ctgtcgaacatggacatggtgctgtcgaagagctcgatcggtatcgcctcgcgctatgcc
gaacttgtggaggacgtcgatgttcgtgagcgcatcttcggccgcatccgcgccgaatgg
cattcctcgatcgagtatctgtttgcgatcatgcagcaggaccgcctgctgcagagcaac
ccgctgctcgaacgctcgatccgccaccgcttcccgtatcttgaccccctgaaccacgtc
caggtccagctgctgcgcgaacaccgcacccacgatccggacgaacaggtgctccgcggc
gtgcaactgacgatcaatgggatttcggcggggctgcggaatagcgggtga

DBGET integrated database retrieval system