KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3959Help
Entry
Rpdx1_3959        CDS       T01381                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00630  Glyoxylate and dicarboxylate metabolism
rpx00710  Carbon fixation in photosynthetic organisms
rpx01100  Metabolic pathways
rpx01120  Microbial metabolism in diverse environments
rpx01200  Carbon metabolism
Module
rpx_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rpx_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rpx_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rpdx1_3959
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rpdx1_3959
Enzymes [BR:rpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rpdx1_3959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772
Motif
Other DBs
NCBI-ProteinID: ADU45515
UniProt: E6VIT8
LinkDB All DBs
Position
complement(4245750..4246172)
Genome map
AA seq 140 aa AA seqDB search
MRLTQGCFSFLPDLTDEQIAAQVQYALSKGWAVNLEFTDDPHPRNTYWEMWGLPMFDLQD
AAGVMMELNECRKIYGDRYIRLSAFDSSHGWESVRLSFIVNRPKDEPGFRLDRQESDGRN
MRYTTRAYSADKPEGRRYGG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgacccaaggctgtttctcgttcctgcccgatctcaccgacgagcagatcgcc
gcccaggtgcaatacgcgctgtccaagggctgggcggtgaacctcgaattcaccgacgac
ccgcatccccgcaacacctattgggagatgtggggcctgccgatgttcgatctgcaggac
gccgccggcgtgatgatggagctgaatgaatgccgcaagatctatggcgatcgctacatc
cggctgtcggcattcgattcttcgcacggctgggaatcggtgcggctgtcgttcatcgtc
aaccgcccgaaggacgaacccggcttccggctcgaccgtcaggagtccgacggccgcaac
atgcggtacaccacgcgcgcctattcggccgacaagcctgaaggccgccgctacggaggc
tga

DBGET integrated database retrieval system