KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_3975Help
Entry
Rpdx1_3975        CDS       T01381                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00860  Porphyrin and chlorophyll metabolism
rpx01100  Metabolic pathways
rpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rpdx1_3975
Enzymes [BR:rpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Rpdx1_3975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 SRP54 CBP_BcsQ NB-ARC AAA_25
Motif
Other DBs
NCBI-ProteinID: ADU45531
UniProt: E6VJI1
LinkDB All DBs
Position
complement(4262493..4263431)
Genome map
AA seq 312 aa AA seqDB search
MNILTDPNKLKTSGCADVNAGKCAEGDGEGSVQVQLDPNVKIGTAKVFSIYGKGGIGKST
TSSNLSVAFSKLGKRVLQIGCDPKHDSTFTLTKKLMPTVIDVLESVNFHSEELRPEDFVF
EGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFASP
LQHSERAMIVAANDFDSIFAANRIAAAIQAKSKNYSVRLAGLIANRSRETDQIDKFGART
GIQRVAHLPDLDVIRKSRLKKMTLFEMDHTAEIEAVQNEYLRLATELWEAKEPPVQGKPL
KDRDIFDLLGFD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctgactgatcccaacaagctgaaaacctcgggctgcgccgacgtcaatgcc
ggcaaatgcgccgagggcgacggcgagggcagcgtccaggtccagctcgaccccaacgtc
aagatcggcaccgccaaggtgttctcgatctacggcaagggcggcatcggcaagagcacg
acctcgtcgaacctgtcggtggcgttctccaagctcggcaagcgcgtgctgcagatcggc
tgcgatccgaagcacgactccaccttcacgctcactaagaagctgatgccgacggtgatc
gacgtgctggagtcggtgaacttccactccgaggagctgcgccccgaggacttcgtgttc
gaaggctacaacggcgtgatgtgcgtcgaggccggcggtccgccggccggcaccggctgc
ggcggctacgtcgtcggccagaccgtcaagctgctcaaggaacaccatctgctcgaagac
accgacgtggtgatcttcgacgtgctcggcgacgtggtgtgcggcggcttcgcctcgccg
ctgcagcattccgagcgggcgatgatcgtcgccgccaacgacttcgattcgatcttcgcc
gccaaccgcatcgccgcggcgatccaggcgaagtcgaagaactacagcgtgcggctggcg
ggactgattgccaatcgcagccgcgagaccgaccagatcgacaagtttggcgcacgcacc
ggtatccagcgcgttgcgcatctgccggacctcgatgtcatccggaagagccgtctcaaa
aagatgacactatttgagatggatcacaccgcagaaatcgaagctgtgcaaaatgaatat
cttcggctcgctaccgaattgtgggaggcgaaggaacccccggtccagggcaagccgctg
aaggatcgcgacatctttgatctcttgggatttgattga

DBGET integrated database retrieval system