KEGG   Rhodopseudomonas palustris DX-1: Rpdx1_4629Help
Entry
Rpdx1_4629        CDS       T01381                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rpx  Rhodopseudomonas palustris DX-1
Pathway
rpx00564  Glycerophospholipid metabolism
rpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rpdx1_4629
Enzymes [BR:rpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Rpdx1_4629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADU46176
UniProt: E6VCC3
LinkDB All DBs
Position
complement(4968584..4970119)
Genome map
AA seq 511 aa AA seqDB search
MVYDLAIIGGGINGCGIARDAAGRGNSVFLCEMNDLASGTSSWSTKLIHGGLRYLEYFEF
RLVREALIERERLWQIAPHIIGPLRFVLPHHDGLRPAWRLRLGLFLYDYLGGRKLLPPTR
SVDLAHDEVGKPLIPGRYSKGFEYSDCFVDDARLVVLTARDAAERGAEIRTRTRAVDVRQ
EGGIWEVTLQHEGSCTRSKIQARALVNAAGPWVEGVLAAGAGVDARYKVRLVQGSHIVTR
KLYDHDRAYIFQNADGRIVFAIPYQGDFTLIGTTDRDYHGDPSQVKATPEEIDYLCKAVS
GYFAKAVTPADVVWTFSGVRPLYDDGASEAKAATRDYVFELDTPGGAPLLSIYGGKITTY
RRLAEEALEKLSPYLKGGAAEQGWTAHQPLPGGDFPIDGAPALIGDLLRDYPFLSSAHAS
RLVHAYGTRARQILGTAKSAADLGRDFGATLTEVEVRYLMSREWACSAEDIVWRRSKLGL
RLTPDAVAALDEWLTVHRAAEKPQTQAGASA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacgacctcgcgatcattgggggcgggatcaacggctgcggcatcgcgcgcgat
gcggcgggccggggcaattccgtgttcctgtgcgagatgaacgacctcgccagcggcacc
tcgtcgtggtcgaccaagctgatccatggcgggctgcgctatctcgaatatttcgagttt
cgcctggtgcgcgaagcgctgatcgagcgcgagcggctgtggcagatcgcgccgcacatc
atcgggccgctgcgcttcgtgctgccgcatcacgacggcttgcgtcccgcctggcggctg
cggctcggcttgttcctgtacgactatctcggcggacggaagctgctgccgccgacccgt
tcggtcgatctggcgcatgatgaagtcggcaagccgctgatccccggccgctacagcaag
ggcttcgaatactccgattgcttcgtcgacgatgcgcggctggtggtgctcaccgcgcgc
gatgccgccgagcgcggcgccgagatccgcacccgcacccgcgcagtggacgtgcgccag
gagggcggcatctgggaagtgacgctgcagcacgagggaagctgcacccgcagcaagatt
caggctcgggcattggtcaatgccgcggggccgtgggtcgagggcgtgctcgccgccggt
gccggggtcgatgcacgctacaaggtgcggttggtgcagggctcgcacatcgtcacccgc
aagctctacgaccacgaccgcgcctacatcttccagaacgccgacggccgcatcgtgttc
gcgattccgtatcagggcgacttcaccctgatcggcaccaccgaccgcgattatcacggc
gatccgtcgcaggtgaaagcgacgccggaagagatcgactatctgtgcaaggccgtcagt
ggctatttcgccaaggcggtgacgccggccgatgtggtgtggacgttttcgggcgtgagg
ccgctgtacgacgacggcgccagcgaggccaaggccgcgacccgcgactacgtgttcgaa
ctcgacacgcccggcggcgcgccgctgttgtcgatctacggcggcaagatcaccacctat
cgccggctcgccgaagaggcgctggagaagctgtcgccgtatctgaagggcggcgccgcc
gagcaaggctggaccgcgcatcaaccgctgccgggcggcgattttccgatcgacggcgcg
ccggcattgatcggcgatctgctgcgggactacccgttcctgtcctccgcccacgcctcg
cgcctggtgcatgcctacggcacccgggcgcgccagatacttggcacggccaagtcggcg
gccgatctcggccgggacttcggcgctacgttgacggaggtcgaggttcgctatctgatg
agccgtgagtgggcctgcagcgccgaggacatcgtttggcggagatccaagctcgggttg
cggctgacgcctgacgctgtcgccgcgctcgacgagtggttgaccgtccatcgcgccgcc
gagaagccccagacacaggcaggagcgtcggcatga

DBGET integrated database retrieval system